KEGG   Thermus aquaticus: TO73_0165Help
Entry
TO73_0165         CDS       T04117                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
taq  Thermus aquaticus
Pathway
taq00670  One carbon pool by folate
taq01100  Metabolic pathways
taq01120  Microbial metabolism in diverse environments
taq01200  Carbon metabolism
Module
taq_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:taq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TO73_0165
Enzymes [BR:taq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     TO73_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ALJ90030
UniProt: B7A942
Position
complement(138572..140203)
Genome map
AA seq 543 aa AA seqDB search
MIVKETLLPIEEVAGKLGLGRERLYPYGPHMAKVLGEPPKARGRLILVTAITPTPAGEGK
TTTAIGLVDALWRLGKKAALALREPSLGPVFGVKGGATGGGRARVEPRHEINLHFTGDFH
AVTSAVNLLNALLDNHLHQGNELSLDPRRIELKRAIDMNDRALRHIVLGLGGRAHGVPRE
GGFELTVASEVMALMSLAQDFADLKRRLGRIRVGFTYEGKPVYAEDLGAVGAMAALLKQA
FLPNLVQTAEGNPAFVHMGPFGNIAHGTNSVRASRFALGLADYVVQEAGFATDLGLEKFM
NVVARTSGLVPEAVVLVATIRALRYHGGQDAYEMPDPKAVERGLANLAKHVENVELFGYR
PVIALNRFPTDALEEVALVRAFAEERGLPFAVSEVYAKGSEGGLELAEKVLEALSLPHQY
RPLYPLEAPLEAKVETIAKEVYGAQGVEWSEEAKKALKAAKKEGCEALPVVMAKAATSLS
DNPRLRGRPTGFTVRVTDLRCRFGAGFVVVYMGGIETLPGLPKLPQALKIDVDEEGNIRG
MDY
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaaggaaactcttctacccatagaggaggtggcgggcaagctgggccttggc
cgggagcggctttacccctacggcccccacatggccaaggtcctgggcgagccccccaag
gccagaggcaggctgatcctggtgacggccatcacccccaccccggcgggcgaggggaag
accaccacggccatcggcctggtggacgccctctggcgcctgggcaagaaggcggccctg
gccctcagggagccctccctgggccccgtcttcggggtcaagggaggggccacggggggc
ggaagagcccgcgtggagccccggcacgagatcaacctccacttcaccggggacttccac
gccgtcaccagcgcggtgaacctcctgaacgcccttctggacaaccacctgcatcagggg
aacgagctttccctagaccccaggcgaatagagctcaagcgggccatagacatgaacgac
cgggccctgaggcacatcgtcctgggcctcgggggcagggcccacggcgtgccccgggaa
ggggggtttgagctcacggtggccagcgaggtcatggccctcatgagcctggcccaggac
ttcgccgacctgaagcgccgcctggggaggatccgggtgggcttcacctatgaggggaag
ccggtctacgccgaggacctgggagcggtgggggccatggctgccctcctaaagcaggcc
ttcctccccaacctggtgcagacggcggaggggaacccggccttcgtccacatgggcccc
ttcggcaacatcgcccacggcaccaactccgtgcgggcgagccgcttcgccctgggcctg
gccgactacgtggtccaggaggcgggcttcgccaccgacctgggcctggagaagttcatg
aacgtggtggcccgaacctcgggcctcgtccccgaggccgtggtcctggtggccaccatc
agggccctccgctaccacggggggcaggacgcctacgagatgcccgaccccaaggcggtg
gagaggggcctggccaacctggccaagcacgtggagaacgtggagctcttcggctaccgg
cccgtcatcgccctgaaccgcttccccacggacgccctcgaggaggtggccctggtccgg
gccttcgccgaggagcgggggctaccctttgccgtgagcgaggtctacgccaaggggagc
gagggcggcctggagctggcggagaaggtgctggaggctttaagcctccctcaccagtac
cggcccctctaccccctcgaggcccccctggaagccaaggtggagaccatcgccaaggag
gtctacggggcccagggcgtggagtggagcgaggaggccaaaaaggccctcaaggcggcg
aagaaagaagggtgcgaggccctgcccgtggtcatggccaaggcggccacctccctctcc
gacaaccccaggctccggggccgccccacgggcttcaccgtgcgggtcaccgacctgcgg
tgccgctttggcgccgggttcgtggtggtctacatgggggggattgagaccctccccggc
ctgcccaaactcccccaggccctgaagatagacgtggacgaggagggcaacatccggggc
atggactactaa

DBGET integrated database retrieval system