KEGG   Thermoplasmatales archaeon BRNA1: TALC_01525Help
Entry
TALC_01525        CDS       T02532                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
tar  Thermoplasmatales archaeon BRNA1
Brite
Enzymes [BR:tar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TALC_01525
Transfer RNA biogenesis [BR:tar03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TALC_01525
Chromosome and associated proteins [BR:tar03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TALC_01525
   HAT complexes
    Elongator complex
     TALC_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: AGI48495
UniProt: M4YN38
Position
complement(1410504..1412036)
Genome map
AA seq 510 aa AA seqDB search
MDEIADRIIEAMRSGEVTDRDSLQRLKMRLCSEYGPDKVPPNSEILAHVSDEERKQFLPL
LVKKPMRTASGVAVVAVMTSPYPCPHGKCAYCPGGVSNVSPQSYTGKEPAARRAAMNRFD
PYDQVAARIAQLEEIGHDVSKIDLIIMGGTFTSRNPQYQEWFVKRCFDAMNGVVKPDMAS
AQEYNSRCEHRCIGLTVETRPDYFMKEEQIRRMMDLGATRVELGVQILDDEVLKGVSRGH
SVEEVRKATSACRGLGLKVCYHIMPGLPGSSPDNDYRCFRRIFDEPDFRPDMLKFYPTLV
VAGTHLYEMWENGEYEPLDTDTAVELVSKMKAYVPEYVRIQRIQRDIPVPEISAGILKSN
LRQLVQNNMDAHGMRCRCIRCREVGHTGAVLEDPEKVILKITEYEASGGKERFIAYEYED
SLVGYVRLRTDDSDVAKIRELKVFGNETAVGKAAESWQHRGFGKKLLAHAEDIARSEGKT
KITVTSGVGVREYYASVGYRLEAPYMAKDL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatcgccgaccgtataatcgaggcgatgaggtcgggtgaggtcaccgaccgc
gattccctccagcgcctcaagatgcgtctgtgctcggagtacgggccggacaaggtcccc
cctaactccgagatcctggcacatgtatcggacgaggagaggaagcagttcctacccctt
ctcgtgaagaagcccatgcgcaccgcttcgggcgtcgccgtcgttgccgtcatgacctct
ccgtacccctgcccccacggcaagtgcgcctactgcccgggaggggtctccaacgtctcc
ccccagtcctacaccggtaaggagcccgccgccaggagggccgccatgaaccgtttcgat
ccctacgaccaggtggccgcgaggatcgcgcagctggaggagatagggcacgacgtctcc
aagatcgacctcatcatcatgggagggacgttcacctcccgcaacccccagtatcaggag
tggttcgtcaagaggtgcttcgacgccatgaacggcgtggtgaagccggacatggcatcc
gcccaggagtacaactcccgctgcgagcaccgctgcatcggtctcacagtcgagacccgt
ccggactatttcatgaaggaggagcagatccgcaggatgatggacctgggcgccacccgc
gtggagctgggggtccagatcctcgacgacgaagtcctcaaaggggtctccagagggcac
agtgtggaggaggtgaggaaggccacctctgcctgccgcggcctcggtctgaaggtctgc
taccacatcatgcccggcctcccgggttcctcccccgataacgattacaggtgcttcagg
cgcatattcgatgagccggacttccgtccggacatgctgaagttctaccccaccctggtg
gtcgcgggcacccacctctacgaaatgtgggagaacggggagtacgaacccctggatacc
gacaccgcggtggaactggtgtcgaagatgaaggcatacgttcccgaatacgtccgtatc
cagaggatccagagggacatccccgttccagagatctccgcggggatcctcaagagcaac
ctcaggcagctcgtgcagaacaatatggacgcccacggcatgaggtgcaggtgcatcagg
tgccgcgaggtcggccacacaggcgccgtcctggaggacccggagaaggtgattctgaag
ataaccgaatacgaggcctccggagggaaggagaggttcatcgcctacgagtacgaggat
tccctggtgggatacgtacgtctccgcaccgacgattccgatgtcgcgaagatccgcgaa
ctgaaggtcttcgggaacgagacagcggtcgggaaagcagcggagagctggcagcacagg
gggttcggaaagaagctgctggcacatgccgaggatatcgctcgttcagaagggaagacg
aagataaccgtcaccagtggggtaggcgtgcgcgagtattacgcctcggtcgggtacagg
ctggaagcgccgtacatggcgaaggacctgtga

DBGET integrated database retrieval system