KEGG   Taylorella asinigenitalis MCE3: TASI_0015Help
Entry
TASI_0015         CDS       T01634                                 

Definition
(GenBank) Coproporphyrinogen III oxidase, oxygen-independent
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00860  Porphyrin and chlorophyll metabolism
tas01100  Metabolic pathways
tas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TASI_0015
Enzymes [BR:tas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     TASI_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AEP35806
UniProt: G4QCY9
Position
19172..20539
Genome map
AA seq 455 aa AA seqDB search
MQNLIQKYNIPGPRYTSYPTVPYWDDSTFSPEAYLESLSRSFKESNTKEGISIYIHLPFC
EQLCTFCACHKRITKKHSVEEPYIEAVLKEWKLYLDLFKDVVNVKEIHLGGGTPTFFKPE
NLRKLIEGLFADGQAKVAPNHSFSFEGHPNNTTEDHLKTLYYLGFRRASFGVQDYDPIVQ
KAINRKQLFSDVEHITNAARDIGFDSISHDLVFGLPFQNWERMEYTIRKTIELKPDRLAF
YSYAHVPWIKGVGQRGFDEGDLPSGEEKRKLYENGKLLLQELGYVEVGMDHFSLPTDELY
QSMLNKKIHRNFMGYTSSSTQVMVGLGASSIGDSWYGFVQNIKEVEAYYEGLAKGGFPFL
RGHILSDEDLIIRRHILNIMCLLETSWEQESMQFPELPQVLVRLEEMQSDGLLEIYPNGL
KVTDAGRTYVRNICMAFDLRMLRNQPETRIFSMTV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatctgatacaaaaatataatattcctggtccaaggtataccagttatcctact
gtaccttattgggacgatagtacattttcacctgaagcgtatttggaatctttaagtaga
agttttaaagaatctaatactaaagaaggtattagtatctacatacatcttccattctgt
gagcaattatgcacattctgtgcctgtcataagcgaatcactaaaaaacattctgttgaa
gagccctatatagaggctgtattgaaggagtggaagctttatctcgatttatttaaggac
gtggttaatgtaaaagagattcatcttgggggtggcactcctacattttttaaaccagaa
aatttgcgtaaattaatcgagggtttgtttgcggatgggcaggctaaagtcgcaccaaat
cacagttttagctttgaaggtcatccaaataacacaactgaagatcatcttaaaacttta
tattatttaggatttagaagagctagttttggtgtgcaagactacgatcctatagttcaa
aaagctataaatcgtaagcagcttttctctgatgtggaacatattacaaatgcggctagg
gatattggatttgatagcattagccatgatttagtgttcggattgccattccagaattgg
gagcgaatggaatataccattcgcaaaacgattgagctaaaaccagatagattggcgttt
tatagttatgctcacgtaccttggattaagggggttggtcagcgcggttttgatgagggt
gatttaccttcaggagaggaaaaacgcaaactatacgaaaatgggaagttgctactacaa
gaattgggatatgttgaagtagggatggaccacttttcattgccaacagatgaactctat
caatctatgctcaataaaaaaattcatcgcaattttatgggctatacatcctcaagtacg
caagtgatggttggtctaggagcatcttcaataggcgattcttggtatggttttgttcaa
aatatcaaagaagttgaagcgtattatgaggggcttgcaaagggtggattccctttcttg
cgtgggcatattctaagtgatgaggatctcattattagaagacatattttgaatattatg
tgtttgcttgaaacaagctgggaacaagagtccatgcaattcccagagctacctcaggtg
ctagttagattagaagaaatgcagtctgacggacttttagaaatatatcctaatggtctt
aaagttactgatgctggaagaacttatgtgagaaatatctgtatggcttttgatttacgc
atgttacgcaatcagcctgagacacgcatattttctatgacagtttag

DBGET integrated database retrieval system