KEGG   Taylorella asinigenitalis MCE3: TASI_0086
Entry
TASI_0086         CDS       T01634                                 

Definition
(GenBank) Uncharacterized protein ImpJ/VasE
  KO
K11893  type VI secretion system protein ImpJ
Organism
tas  Taylorella asinigenitalis MCE3
Brite
KEGG Orthology (KO) [BR:tas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tas02044]
    TASI_0086
Secretion system [BR:tas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TASI_0086
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AEP35877
UniProt: G4QD60
Position
88679..90028
AA seq 449 aa
MSISNKVIWSEGMFLRPQHFQQQDRYLDSKQRVLLEASPTYYWGFYQLEIDQNALKENKL
AITKAAGIFKDGTPFSLNGNDVPMLPLDSFAREEMIYLVLPSKEASRQEVSYEEGSDLLA
RFSVVETTLSDVSDITLGEAPVQIGKPQFKFMPDSEIDGNWVKLPVVHFKGKNKLNIVEV
DTGFIQPTINCAFVNNPITDHLSRVVDLLNLRSTELSKRFNPNNRTSASTTYETIILGIV
NRNLILFKHLYTLEYLHPEVFFRYLSMLVAELAMFHPDSISINKIPSYDHDALKVPLENL
MSQIGDALNIVFEDAYVTIPLEDKGHGLSVGKVPDKNLFAKSQFVLAVKADLPGESVRKT
FPQQAKLGPTNRMRDLVHLQLPGITLEHMDQVPAALPYHAGYIYFNLVKEGDMWNQFEKS
STLALHLAGDYPGLDMQFWAVKNTDKRNS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgagcataagtaataaagttatttggtctgagggcatgtttctgcgccctcagcatttt
caacaacaagatagatacctagactctaagcaaagagttcttcttgaagcttccccaacc
tactattggggcttttatcaattagagattgatcaaaatgcacttaaagaaaacaagtta
gctattactaaagctgcaggtatttttaaagacggaactccattctctttaaacggaaat
gatgttccgatgcttccattagattcttttgcacgtgaagagatgatttatttggttctt
ccatctaaagaggcttctcgtcaagaagtttcatatgaagaaggaagtgatttgctcgct
agatttagtgttgttgaaactactttaagtgacgtatctgatattactttaggtgaggca
ccagttcaaattggtaagcctcagtttaaatttatgcctgattcagaaattgacggaaat
tgggtaaaacttcctgtagtgcattttaaaggtaaaaataaacttaatattgttgaagtt
gatactgggtttatccaaccgacaataaattgtgctttcgtaaataatccaattaccgat
catttatcaagagttgtggatttactaaacctaagatctacagaactttcaaaacggttt
aaccctaataatagaacttcagctagtacaacttatgagactattattttaggtattgta
aatagaaacctaattctatttaaacatctatatacacttgaatatctgcatccagaagta
ttttttagatatttatctatgcttgtggctgagcttgctatgttccatccagatagcatc
tctatcaataaaattccttcatatgaccatgatgctttaaaagtgcctctagaaaatttg
atgagccaaatcggcgatgcacttaatatcgtattcgaagatgcttacgttactatccca
ctcgaagacaaaggtcatggacttagtgtcgggaaagttccagataaaaatctattcgca
aaatcacaatttgtacttgcggtcaaagccgatttgccaggggagtctgtacgcaaaaca
ttccctcaacaggcgaaattgggacctacaaaccgtatgcgagatcttgtacatctacaa
ctacctggcattacgcttgagcatatggatcaagttccggcagcattgccatatcatgca
ggatatatctactttaatttagttaaagaaggcgatatgtggaatcaatttgaaaaatca
tcaacactagcccttcatctagcaggagattatccaggccttgatatgcaattctgggct
gtaaaaaacactgataaacgtaattcttag

DBGET integrated database retrieval system