KEGG   Taylorella asinigenitalis MCE3: TASI_0088
Entry
TASI_0088         CDS       T01634                                 

Definition
(GenBank) IcmF-related protein
  KO
K11891  type VI secretion system protein ImpL
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TASI_0088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tas02044]
    TASI_0088
Secretion system [BR:tas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TASI_0088
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_28
Other DBs
NCBI-ProteinID: AEP35879
UniProt: G4QD62
Position
91553..95014
AA seq 1153 aa
MYLIIAIFALYFLRLFWRKYREGRLNAKLLGQLKSNKPKDTEKLTEKEREEVRVLSERFN
EAITLLKQSRFEKGKDKSFSARFSKQYLYQLPWYVFIGAPGSGKTTALVNSGLNFPLAEK
FGRMALKGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSNAATDEDEWKGFLKLLTKYRARQ
PINGVMLTVSVYDLLASTQEERAKHAVALKKRLQELRDELGTEFPVYILVTKMDQLHGFE
DYFDNLSVEEHQQVWGFTFPYEESQKDGFDFYEEYEKEFQVLQERLFDGLPDLLMKNRNL
ESSSLAYLLPQQFANLRIVLGTFLTDVFSFSRLESKIVPRGVYFTSGTQGGVSFDKVSEE
LKDYLQIDGISQHNKAPMLEGGKSYFLTDLLQNLIFKESGLAGVNLKWEKRYRQIQWIGY
GLVGLLLLGALTLWFNSYRNNSRYLDFVEEKLPVVQNHSNNIKISESGDVFSILPYLSLV
KKLPNGENFLVDDAPFSYGFGLYQGGKVKSASRSIYDDAIHQVFAPQIAKRIEKRLATMS
DANIVIYYEALRAYLMMYEPEHYDKDYFTQWVLHDVVADKSAQFNNEQFQLLREHMDYLF
GQGAFVSPFPLNEELVQEARNRIDSHDLAQRAYLRAREILKQDPKNDVTLMTLAGNQAST
VFRRKSGDALNRGVNRIFSYEGYWNIFNKNIEKISIQLREDDEWILGIDNTTFADGSANK
LLNEVKKLYFVDYIREWDAFLADIEVIPPKNLSHAIELSRSMSSTNSPLTKFVKGVAGDT
TLLREDVNFQRTLVDRATESASSMASSLTSLMGPLDTGDLIKGKEEPTKLESMVDNHFIG
YHELAVSAGNNTPAPIEGTIDLIEELYNFLTASETALRTKVTLPSQEVISKLQAESGRLP
PVVGSMLTSITTEASKAINSGAQANIGADINAQIGMSCRNSITNRYPFRSTTRDVAPNDF
ARFFAPNGLMDQFFNKNLINMVDMSKRPWRFKPGVDGSKGNIAKYLSSFEKASVIRDVYF
AGGKPEPSFKVSIRPVEMDANITQMVLNIDGQTLTYEHGPQVGKSFDWPGQGSNQVSITL
SPHDGTSSLTTNGPWALNRLIDNAKISRGRSPEVIFATFNIGGRSVKLEITANSAKSPFR
LGEMRSFVCPGVN
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgtacttaatcattgccatctttgcgttgtattttcttagattattctggagaaaatat
cgtgaggggcgtttgaatgcaaaacttttgggacagctcaaaagcaataagcctaaagat
accgaaaaacttaccgaaaaagaacgcgaagaagtacgtgttttatctgaacggtttaac
gaagcaattacattactaaaacaatcacgatttgaaaaagggaaggacaaatcgttttca
gctagattttctaagcaatatttatatcaattgccttggtatgtttttattggagcacca
ggttcagggaaaactactgcattagtaaattcaggtttaaatttcccattggctgaaaaa
ttcggtcgtatggcgctcaaaggtgtgggtggtacgagaaactgtgattggtggtttact
gatgaagcggttctacttgatactgctggaagatacacaactcaggatagtaatgctgct
actgatgaagacgagtggaagggattcttaaaacttcttactaaatatagagctaggcag
cctatcaatggcgtgatgcttactgtcagtgtgtatgatttgcttgcatcaactcaagaa
gagcgtgctaaacatgctgtagcccttaaaaaacgtttgcaggaactaagagatgaattg
gggacagagttccctgtttatattttggttactaagatggaccaattacacgggtttgaa
gattatttcgataatttaagtgtagaagaacatcaacaagtttggggatttacatttcca
tacgaagagtctcaaaaggatggtttcgatttttatgaagaatacgagaaagaattccag
gttcttcaagagcgtttatttgatgggcttccagacttattaatgaaaaatcgaaatctg
gaaagtagttccttggcgtatttattgccacagcaatttgcaaacttaagaattgtttta
ggtactttcttaacggatgtattttcttttagtcgccttgaatcgaaaattgtccctcgt
ggcgtttatttcacaagcggaacgcaaggtggtgtaagtttcgataaggttagtgaagaa
cttaaagactaccttcaaatcgatggtatttctcaacataataaagcaccgatgttagaa
ggcggaaagagctacttcttaactgatctacttcaaaatttgattttcaaggaatcaggt
cttgcgggcgtaaaccttaaatgggaaaaacgctatcgccagattcagtggattgggtat
ggcttagttgggttactacttttaggtgcgttaactctttggtttaatagctatcgaaat
aactcacgatatcttgattttgtagaagagaagctgccagttgttcaaaatcatagtaac
aatattaagatctctgaaagcggcgatgtgtttagcatattgccatatttgagtcttgtg
aaaaaactgcctaacggagagaatttcttagttgatgatgctccgttctcatatggtttt
ggtctatatcaaggcggaaaagttaagtctgcttctcgttctatatacgacgatgctatt
catcaagtatttgctccacaaattgcaaaacgcatagagaaacgattagcaaccatgagc
gatgcaaatatcgttatttattatgaggcgttgcgtgcatatttaatgatgtatgaacct
gaacattacgataaagattactttactcaatgggttctgcatgatgttgtagctgataaa
tcggctcaatttaataatgagcaattccagcttttaagagaacatatggattacctcttt
ggtcagggtgcatttgtatcaccatttccacttaatgaagagttagttcaagaagcacga
aatcgtatcgattcacatgatttggctcaacgtgcgtatcttcgtgctcgtgaaatccta
aaacaagatcctaaaaacgatgtaactttgatgactcttgcgggtaatcaagcatccaca
gtatttagacgcaaaagcggtgatgctttaaatcgtggcgttaatagaatcttctcatac
gaaggatattggaatatttttaataaaaatattgaaaaaatatccatccaattaagagaa
gatgacgagtggatattgggtatagataacaccacatttgccgatggtagtgcaaacaaa
cttcttaatgaggttaaaaaactctactttgtagattacattcgtgagtgggatgcgttt
ttggctgacatcgaagttattcctcctaaaaacttaagtcatgcaattgaattgtcccgt
agtatgtcttctaccaactcgcctcttactaaattcgttaaaggggtagcgggtgataca
acccttttgcgtgaagacgttaatttccaaagaactcttgtagatagagctactgaaagt
gcttcaagtatggcttcttcattgacatctttgatgggtccacttgatactggtgatctc
attaaagggaaagaggaacctaccaaattagagtctatggtggataatcactttattggt
tatcacgaattggctgtcagtgcgggaaataacacacctgctccaatcgaggggacgatt
gatctaattgaagagttatataactttttgacggcgtcagaaacagctttgcggactaag
gtaacattgccatcgcaagaagtaatttcaaaacttcaagcagagtctggacgtctacca
ccagttgtgggcagtatgcttacatcaatcacaacagaagcttctaaagctattaactct
ggagctcaagcgaatatcggtgcggatattaatgcacagattggtatgtcttgcagaaac
tctatcactaacagatatccatttagatctaccactcgcgatgttgcacctaatgatttt
gcaaggtttttcgctccaaatggcttaatggatcaattctttaataagaatttaatcaat
atggtggatatgtctaagcgtccatggcgatttaaaccaggggtagatggctcgaaaggg
aacattgccaaatacttatcttcttttgagaaagcttctgtaattcgtgatgtttatttc
gcaggcggcaaacctgaaccttcgtttaaagtttcaatacgtcctgtagagatggatgca
aacattacgcaaatggtacttaatattgatggtcagacattgacttatgagcatggtcct
caagtaggcaaatcttttgattggcctggtcagggaagcaatcaagtttcaattacttta
agccctcatgatggaacttcatctcttacaactaacgggccgtgggctcttaatcgactg
atagataatgcgaagatttcgcgtggtcgttcccctgaggttatttttgctacattcaac
ataggtggtagatctgtgaaattagaaatcactgctaactccgcaaaaagcccatttaga
ttgggcgagatgcgaagcttcgtttgcccaggagtgaactag

DBGET integrated database retrieval system