KEGG   Taylorella asinigenitalis MCE3: TASI_0095
Entry
TASI_0095         CDS       T01634                                 

Definition
(GenBank) Protein of avirulence locus ImpE
  KO
K11898  type VI secretion system protein ImpE
Organism
tas  Taylorella asinigenitalis MCE3
Brite
KEGG Orthology (KO) [BR:tas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tas02044]
    TASI_0095
Secretion system [BR:tas02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   TASI_0095
SSDB
Motif
Pfam: ImpE TPR_19 P53_C TPR_17
Other DBs
NCBI-ProteinID: AEP35886
UniProt: G4QD69
Position
102465..103298
AA seq 277 aa
MNTAGIFKTNSIQDIIEQTKDKVRKNPGSADLRANLFQLLSLKGDWTKAVDSLKLSAEMN
SQAQPVAMLYVAAVNAEVDRQNVFKGNGRPSIFGDADEWMGYLITSIEEQDPAKSEELLD
QAMELAPEVSGTITTRNGEEIKFEWLADGDSRLGPMLEFLNNGQYGWVPFNEIQSLRIIE
PSGISDLIWSQAELVLSNGRSIVGMVPNRYPGDYANLEDSFNLGHRTEWQPLYENSESEF
YKGVGQKTYMSDVGDHPILEIESIKFNPVQVQDSEEA
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaacactgctggaatttttaaaactaattcaattcaagacattattgaacaaactaaa
gacaaagttcgtaagaatcctgggagtgctgatttgcgtgcaaatttatttcagctctta
tccttaaagggagactggactaaggctgtagatagcctaaaactaagtgctgagatgaat
tcgcaagctcaaccagtagctatgttatatgtagctgcggtaaatgctgaggttgatcgt
cagaatgtttttaaaggaaatggtagaccatcaattttcggtgacgctgatgagtggatg
ggttatttaataacttctattgaagagcaggaccctgcaaaatctgaggaattgcttgat
caggctatggaattagctcctgaagtatcaggaactatcaccacaagaaatggtgaagaa
atcaagtttgagtggcttgctgacggtgatagtagattaggtccaatgcttgaattttta
aataacggtcagtacggatgggtaccgtttaacgaaattcaatccttaagaataattgaa
ccttctggtatttcggatcttatctggtctcaagcagaacttgttttaagcaatggtcgt
tctattgttggaatggtaccgaatcgctatccaggcgattatgcaaatcttgaagattct
tttaatttagggcatagaaccgagtggcagcctctgtatgaaaattctgaatcagaattt
tataaaggtgtcggtcaaaaaacatatatgtcagatgttggtgatcacccaattctagaa
attgaatctattaaatttaatccagttcaagttcaggattcagaagaagcctaa

DBGET integrated database retrieval system