KEGG   Taylorella asinigenitalis MCE3: TASI_0108
Entry
TASI_0108         CDS       T01634                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TASI_0108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tas02044]
    TASI_0108
Secretion system [BR:tas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TASI_0108
SSDB
Motif
Pfam: Phage_GPD Phage_base_V bCoV_SUD_C
Other DBs
NCBI-ProteinID: AEP35899
UniProt: G4QD82
Position
118242..119795
AA seq 517 aa
MADRHAIAHVAIPSLQFLSLNGHESLSNLYEFEVELVSMDNFIDVRKMLGTQLTVELESF
MSTPRYLTGRVRKFELVGSDQDGSEYLIYKAHVVPPLWYLTQGKDYKIFQEKKIEDIIKE
ILDKFEIKYEFKLSGSYRNWEYVVQYNESPFNFISRLMEHEGMYYWFKHDKNESTMVISD
DASSHEEYPSYETLNYLSSGFKVFDSREVITSWRHNAVVTPSKYTVVDFDFRKPSTALDT
EKENQLDGDDSIEVYEWQGGYQELSDGDNYTKLRLEELKVPQEIVEADSNIRGICPGYKF
TLANHPRPSENQDYVVVQAHYMVQVNGYSTNSGREDFFSTSFYSLPASIQFRAARRTPEP
KTHGPQTATVVGPSGEVIYTDKYGRVKVQFHWDRDGKKDENSSCWVRVSSPWASTGFGGL
QIPRIGDEVVIDFIGGNPDRPLIIGRVYNEDNQPLVNLPNDSHTSGFRTRTIQGGSDNQN
FLLFRDKQGDELVDVQAEKDMKIFVKNDFYLTVGNCG
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcagaccgtcacgcaatcgcacatgtagcgatacctagtcttcagtttttaagtctt
aacgggcatgaatccctttcaaatttgtatgaatttgaagttgaacttgtatctatggat
aattttattgatgtgcgtaaaatgcttggcacacaacttactgtcgaattagagtcattt
atgtccacgcctaggtacctgactggtcgtgttcgtaagtttgaattagttggatctgat
caggatggttcagaatatttaatttacaaggcacatgttgtacctcctttgtggtatctg
actcagggtaaagattataaaatctttcaagagaaaaaaatcgaagacataatcaaagaa
atcttagataaatttgaaatcaaatacgagtttaagctttcaggttcttacagaaattgg
gagtatgtagttcaatacaatgaatctccttttaacttcatttcaagattaatggaacat
gagggtatgtactattggtttaaacatgataaaaacgaatctactatggttatctctgat
gatgcttcatctcatgaagagtacccttcttatgaaacacttaattatttgtcttctgga
tttaaggtttttgattccagagaggttattacttcttggagacataatgcagtagttacg
ccttcgaaatatacggttgtggattttgattttagaaagccaagcactgcattagataca
gagaaagaaaatcaacttgatggtgatgatagtattgaagtttatgaatggcagggtgga
tatcaggaattatctgatggcgataattatactaaattaagactggaagaattaaaagta
cctcaggaaattgtagaagctgattctaatattcgtggtatttgtcctggttataagttt
acgcttgcaaatcatccaaggccttctgaaaatcaagattatgtagttgttcaagcccat
tacatggttcaggttaatggctattcaaccaactcaggtagagaagattttttcagtact
agcttttattccttgccagcatcaatacaattccgtgcggctcgtagaactccagagcct
aaaactcacggacctcaaacagctactgttgtcggcccttctggagaagtgatttatact
gataaatacggtagagttaaagtgcaattccactgggatcgtgatggtaaaaaagatgag
aactcttcttgttgggttcgtgtctcaagtccctgggctagtactggttttggtggttta
caaattcctcgtattggagatgaagttgttattgattttattggtggtaacccagataga
ccattaattatcggcagggtttataacgaggataaccagcctttagttaatctaccaaat
gattctcatacctcaggcttccgcacaagaacaattcaaggcggtagcgacaatcaaaat
ttccttttgtttagagacaaacaaggagatgaattggtggacgttcaagcagaaaaagat
atgaagatatttgttaagaatgacttttacttaacagttggtaattgcggttaa

DBGET integrated database retrieval system