KEGG   Taylorella asinigenitalis MCE3: TASI_0142Help
Entry
TASI_0142         CDS       T01634                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00010  Glycolysis / Gluconeogenesis
tas00260  Glycine, serine and threonine metabolism
tas00680  Methane metabolism
tas01100  Metabolic pathways
tas01110  Biosynthesis of secondary metabolites
tas01120  Microbial metabolism in diverse environments
tas01130  Biosynthesis of antibiotics
tas01200  Carbon metabolism
tas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0142
  Energy metabolism
   00680 Methane metabolism
    TASI_0142
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TASI_0142
Enzymes [BR:tas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TASI_0142
Membrane trafficking [BR:tas04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TASI_0142
Exosome [BR:tas04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TASI_0142
  Exosomal proteins of melanoma cells
   TASI_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEP35933
UniProt: G4QDB6
Position
145241..146011
Genome map
AA seq 256 aa AA seqDB search
MRFPNGQLMYKLVLMRHGESQWNLENRFTGWADVDLTDTGRQQAKEAGALLKAEGFDFDI
AYTSVLKRAIRTLWIALDEMDRLHLPVVKSWRLNERHYGNLQGLNKSETAQKFGDEQVLI
WRRAYAIAPDPIDTEDKRHPKFDARYKDLDASQLPSTECLNDTVARVIPLWNEQISEDIK
AGKRVLITAHGNSLRALIKHLDQISDEDIVTLNIPTGQPLVYELDENLKPIKHYYLGDQE
AIAAAVAAVAAQGKAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgagatttcctaacggacagcttatgtataaattagttttaatgcgtcatggtgagagt
cagtggaacctagaaaaccgttttacgggatgggctgatgtagatctcaccgacacaggt
cgtcagcaagcgaaagaagcaggagccttactgaaagctgaggggtttgactttgacatt
gcctacacatcagtattaaaaagggcaattcgcacactatggattgctttagatgagatg
gataggttgcatctgccagtagtaaagtcgtggagactgaatgagcgtcactacgggaat
ctgcaaggcttgaataaatcggagacagcccaaaaattcggggacgaacaagtcctaatt
tggagaagggcatatgcgattgcccccgatcctattgatacagaagataagcgtcatcct
aaatttgatgcgagatataaagatttagatgcctctcaattaccaagcacggagtgtctt
aatgatacggtcgcacgcgtaattccattatggaatgagcaaatctccgaggatattaag
gctggaaagcgtgtattaatcacagcccacggaaatagtttacgtgcattgattaaacat
ttggatcagataagcgatgaggatatcgtaactttaaatattcctacaggccaacctcta
gtttatgagctagacgagaatcttaagccaattaaacattattatcttggcgatcaggag
gccattgccgctgctgtggctgctgttgctgctcaaggaaaggccaagtaa

DBGET integrated database retrieval system