KEGG   Taylorella asinigenitalis MCE3: TASI_1136Help
Entry
TASI_1136         CDS       T01634                                 

Definition
(GenBank) Threonyl-tRNA synthetase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tas00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TASI_1136
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tas01007]
    TASI_1136
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tas03016]
    TASI_1136
Enzymes [BR:tas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     TASI_1136
Amino acid related enzymes [BR:tas01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   TASI_1136
Transfer RNA biogenesis [BR:tas03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TASI_1136
 Prokaryotic type
    TASI_1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS Cyclase DUF2533
Motif
Other DBs
NCBI-ProteinID: AEP36890
UniProt: G4Q9X1
Position
complement(1162391..1164331)
Genome map
AA seq 646 aa AA seqDB search
MIQVTLPDGSSRSYESPQTVAQIAHSIAPSLAKAAIAATVRSNEGIESTVDTSYLIDRDV
SLSIITPKDDIGLDIIRHSTAHLLAHAVKELFPDAQVTIGPVINNGFYYDFSYKRPFTPD
DLEKIEKRMNELAKQDIAVVREEWDRDDAVEFFKKEGELYKAEIISSIPQGETISLYKQG
SFIDLCRGPHVPSTGKLKVFKLMKVAGAYWRGDSNNEMLQRIYGTAWSSKEDQAHYLNML
EEADKRDHRKLGKELDLFHFQDEAPGLIFWHPKGWTIWQQVEQFMRKVYIENGYQEIKAP
QILDLSLWKKTGHWDNYKENMFTTQSENREYGLKPMNCPGHVQIFNSTLHSYRELPIRYG
EFGQCHRNEPSGSLHGMMRVRGFTQDDGHIFCTEDQLLEECSAFTALLQKVYKQFGFDKV
LYKIATRPEKRIGADEIWDKAEEALMESLRSSGCEFEISPGEGAFYGPKIEYTLKDAIGR
HWQCGTIQVDFSMPARLGAEYVDADDTRKTPVMLHRAILGSLERFIGMLIENHAGAMPPW
LSPEQVVVCPISEAFNDYALDVQSKLNEKFRVKVDLRNEKITKKIRENSMQKIPYILVVG
EKERSTSSVAVRARGNVDLGVLTVDEFIARLQNEIDNKLDVVVPSV
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgatacaagtaacccttcctgacggttcttctagaagttacgaaagtccacaaaccgta
gctcagattgcacattcaattgcacctagtttagctaaagctgcaatcgcagcaactgtg
agatcaaatgaaggtattgaatcaacggtagatacaagttatcttattgaccgtgatgtt
tccttgtctattatcacacctaaagatgatattggcttagatattattcgtcactcaaca
gctcacttacttgctcatgcggttaaagaattatttccagatgctcaagtaacaattggt
ccagttataaataatggcttttattatgacttctcctataagagaccatttacacctgat
gatcttgaaaagattgaaaaacgcatgaatgaacttgctaagcaagacatcgcggtcgtg
cgtgaagaatgggatagggatgatgcagttgagtttttcaaaaaagagggtgaactctac
aaagcagagattatttcttctattcctcaaggtgaaactattagtctttacaagcaaggc
tcattcattgacttatgtcgtggtcctcatgtaccgtcgacaggaaagcttaaggtattt
aagttgatgaaagttgcgggtgcttattggaggggagattctaataatgagatgcttcaa
agaatttatggtacagcttggagttctaaagaggatcaagctcattatctgaatatgctt
gaagaagcagataaaagggaccatagaaaattaggtaaagaacttgatttattccatttt
caagatgaagcaccagggcttatcttttggcatccaaaaggctggaccatttggcagcaa
gtcgagcagttcatgcgtaaggtttacatagaaaatggttaccaagaaattaaggctcct
caaattcttgatctcagtttatggaagaaaactggacactgggataactataaagaaaac
atgtttactactcagtctgaaaaccgtgagtatggcttaaaaccaatgaattgtcctggt
catgttcagatttttaattcaactttgcactcatatagagaacttccaataagatatggt
gaatttggtcagtgtcaccgaaatgaaccttcaggctcattacatggcatgatgcgtgtt
cgtggctttactcaggatgatggccatattttctgtacggaggatcagcttttggaagag
tgttctgcatttacggcacttcttcaaaaggtctataaacaattcggattcgataaggtt
ctttataagattgcaactagaccagaaaaaagaatcggtgcggacgaaatatgggataaa
gccgaagaggctcttatggaaagtttacgcagctctggatgcgaatttgagatttctcca
ggtgagggtgcgttttatggacctaagattgagtacacacttaaagatgctattggtcgt
cattggcagtgtggaactattcaagtggatttctcaatgcctgcacgtttgggtgctgag
tatgtggatgcggatgatacccgtaaaactcctgtgatgttacatagagctattttaggc
tctcttgaaagatttatcggtatgcttatagaaaaccatgcaggtgctatgcctccatgg
ttatctcctgaacaagtagtggtatgcccaatttctgaggcatttaatgattatgcactc
gatgttcagtcaaaattaaacgaaaaatttagagttaaggtggatttacgcaacgaaaaa
ataactaaaaaaatccgtgaaaactctatgcaaaaaattccttatattcttgtggttgga
gaaaaagagcgtagcacatcaagtgttgcggttagagccagaggaaatgtggatttaggc
gttttaaccgttgatgagtttatagctcgtcttcaaaatgaaatcgataacaaattagat
gttgtcgtaccatctgtttaa

DBGET integrated database retrieval system