KEGG   Taylorella asinigenitalis MCE3: TASI_1381Help
Entry
TASI_1381         CDS       T01634                                 

Definition
(GenBank) Sugar kinase, ribokinase family
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00230  Purine metabolism
tas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TASI_1381
Enzymes [BR:tas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     TASI_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AEP37121
UniProt: G4QA48
Position
complement(1428722..1429672)
Genome map
AA seq 316 aa AA seqDB search
MGNKKPVLICGSVAFDTITKFDGHFKDHLLPENIKSLSVSFFVPTMRKEYGGCAGNIAYA
LNMLGGYAAPVATVGKDSDDYIERMRQLGIATQFIKQIPESFTAQCHITTDLDGNQISAF
HPGAMEFSHTNAIENAFCDWAIVAPDSKAGMFEHARKLHELGVKFIFDLGQAMPLFDATE
LKTMIDLSDALTLNEYEASVVEQRLGMDMRDIANLLDAVVVTMGARGSRLYHDSKMHEIT
TFAPEAVKDPTGCGDAHRGGLLYGLSNGWSWVESASLANIMGALKIAVEGPQNYWHKKET
VNSLLKSVYDIDREIK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataaaaaacctgttttaatatgtggttccgtggcctttgacactattactaag
tttgatggtcattttaaggaccatctacttcctgaaaatataaagtctttgagtgtgtcc
ttttttgtgccgaccatgcgaaaagaatatggtggatgtgcaggaaatattgcgtatgcc
cttaatatgctcggcggctatgctgctccagtagcgacagtcggtaaagactcagatgac
tatattgaacggatgagacaactgggcattgccacccaattcataaagcaaattccagaa
tcatttacagctcaatgccatataactactgatttagatggaaatcagataagtgcattt
catccaggagctatggaattttcccatacaaatgctattgagaatgcattttgtgattgg
gccattgttgctccagactctaaagcgggtatgtttgaacatgctagaaaattgcatgaa
cttggtgtgaaatttatattcgatttagggcaagcgatgccattgtttgatgctactgaa
ttaaaaactatgattgatttgtcggatgcattgacacttaatgaatatgaagcttctgta
gtagaacaaaggctaggtatggatatgagggacattgccaacttgcttgatgccgtggtc
gttactatgggagcaaggggtagcagactttatcatgattctaaaatgcatgaaattact
acttttgcacctgaagcagtaaaggaccctactggatgcggtgatgctcatagaggcggt
ctattatatggtttatctaatggttggtcttgggttgagagtgcaagccttgctaatatt
atgggtgcactaaagattgctgttgagggccctcaaaattactggcataaaaaagagacc
gttaatagtctcttaaaatcagtttatgatatcgatcgggagattaaataa

DBGET integrated database retrieval system