KEGG   Trichosporon asahii var. asahii: A1Q1_01752
Entry
A1Q1_01752        CDS       T06566                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tasa  Trichosporon asahii var. asahii
Pathway
tasa00100  Steroid biosynthesis
tasa01100  Metabolic pathways
tasa01110  Biosynthesis of secondary metabolites
Module
tasa_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    A1Q1_01752
Enzymes [BR:tasa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     A1Q1_01752
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 25985266
NCBI-ProteinID: XP_014180266
UniProt: J5QU34
Position
Unknown
AA seq 480 aa
MGAQKPSYEFGGPLGATAIVFGLPLLMNVLYFGCNDVSGCPAPALLHPSSLSWAKLKTQI
PWPESGLRGFLSWRVIAWLAAYYLLSLVLYRILPATEVYGTKLRESGKPLKYRFNALAAT
MVQLGACAVGTLIWGAEFPVWKFIADNYLQLLTGNLLLSYVISVWVYLRSFTVKLGNKDM
RELAKGGHTGNVIYDFYIGRELNPRVTLPFFGEIDVKAWLEMRPGLTGWILLNCSFIAKQ
VRLHGYVSDSILIVAAVQGYYALEGQYFESGILGMMDIVHDGLGFMLTFGDIVWVPFLYC
TMARYLSVYPVHLGWTRIAVIAAVFSIGLYIFRSANSQKNRFRTNPDHPSVKDMPYIQTK
RGTRLLTGGWWGRARHINYFGDWIQSLPFCLPTGLAGYVIVPAGTGLVGAGVRTMLDGRQ
VTQEGAAPWGMLFTYLYSAYFGFLLIHRERRDDNNCAEKYGEDWEKYRKQVPWRIVPGVY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgggagcgcagaaaccaagctacgagtttggcggaccgttgggcgccaccgccatcgtc
ttcggtcttcctctactcatgaacgtcctctattttggctgcaacgacgtttctggatgc
ccggcgccggcactgctgcacccaagttcgctgtcgtgggcaaagctcaagacgcagatc
ccctggcctgaaagtgggctccggggcttcctcagctggagagtgattgcgtggcttgcc
gcgtactatcttctcagcctcgtactctaccgcattctgccagcgactgaagtgtatggc
accaagctgcgcgagtctggcaaaccgctcaagtatcgcttcaatgctttggcagcgacc
atggtgcagcttggcgcttgtgccgtcggcactttgatttggggggccgagttccctgtc
tggaagtttatcgccgacaactacctgcagctgttgacgggcaacctgctgctgtcctac
gtgatctctgtgtgggtgtacttgcgcagtttcactgtcaagctcggcaacaaggacatg
cgcgagctggccaagggagggcacaccggcaacgtcatctacgacttctacatcgggcgt
gagctgaacccgcgcgtgacgctgccgttctttggcgagatcgatgtcaaggcgtggctc
gaaatgcgccccggactgacgggttggattctcctgaactgctcattcatcgcgaagcag
gttcgcctgcacggctatgtcagcgacagtatccttatcgtcgcggctgtacagggatac
tacgccctggagggacagtatttcgagtcgggcatcctgggcatgatggacattgtgcac
gacggccttggcttcatgctcacctttggcgacattgtctgggttcccttcctctactgc
accatggcgcgttacctctccgtctaccccgtgcaccttggctggacgcgcattgcggtc
atcgcggccgtgttcagcattgggctctacatcttccgctcggccaatagccagaagaac
cgcttccgcaccaaccccgaccacccgagcgtcaaggacatgccgtacatccagacgaag
cgcggcacgcgcctcctcacaggcggctggtggggtcgcgctcgccacatcaactacttt
ggagactggatacagtcacttcccttctgtctcccaactggtctcgcgggctacgtgatc
gtccctgccggaactgggctcgtcggcgctggtgtgcgcacgatgctagatggccgccag
gtcactcaggagggagctgctccgtggggtatgctcttcacctatctgtactcggcgtac
tttggcttcctcctcattcaccgcgagaggagagacgacaacaactgtgcggaaaagtac
ggtgaggactgggagaagtacaggaagcaggtgccctggcggatcgttccgggtgtttac
tag

DBGET integrated database retrieval system