KEGG   Taylorella asinigenitalis 14/45: KUM_0820Help
Entry
KUM_0820          CDS       T02603                                 

Gene name
surE
Definition
(GenBank) 5'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
tat  Taylorella asinigenitalis 14/45
Pathway
tat00230  Purine metabolism
tat00240  Pyrimidine metabolism
tat00760  Nicotinate and nicotinamide metabolism
tat01100  Metabolic pathways
tat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KUM_0820 (surE)
   00240 Pyrimidine metabolism
    KUM_0820 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KUM_0820 (surE)
Enzymes [BR:tat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     KUM_0820 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: CCG19612
UniProt: I7IBY5
Position
complement(866941..867711)
Genome map
AA seq 256 aa AA seqDB search
MTTKILLANDDGYYALGLEKLYDELSKWAEVVVFTPEINHSGASNSLSINRPLSLKKSSK
GFNIINGTPSDCVHVALTNFLDFVPDIVVSGINNGANLGEDTLYSGTVAAATEGYLFGYQ
SIAFSLTHYNWPNIDEAASIANEFVKLIVANPTETKTLLSINIPPKDSYSINDFRVTRLG
RRHQSQPVERTKSPFGQELFWIGASGEIMDFGEDTDFYAVDNGYISVTPIQLDMTHYKKL
ESTKSWLSNVVKTVSD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaaaatcctcttggctaacgatgacggctattatgctcttggtttagaaaaa
ctttatgatgaactttctaaatgggcagaggtagtggtattcactcctgagatcaatcat
agtggagcttctaattcattatctattaatagacctttaagcttaaaaaaatcttctaaa
ggtttcaatatcataaatggtactccaagtgattgtgtccatgtagcgttaaccaatttt
ttggactttgttcctgatattgttgtgtctggcataaataatggtgcaaacttgggtgag
gatactctatattcaggtacggttgctgcagcaactgaagggtatttatttggttatcag
tctatagctttttctttaactcactacaattggcccaatattgatgaagctgcaagcatc
gctaatgaatttgtgaaattaattgttgctaatcccactgaaactaaaacattactaagt
ataaatatcccacctaaagactcctatagtattaatgattttcgtgtaactagactaggt
cgacgtcatcaatctcaaccagttgaaaggaccaaaagtccatttggacaggagctattc
tggattggtgcctctggtgaaatcatggattttggcgaggacacagatttttatgcggtg
gataatggttatatttctgttactcctatccaattggatatgactcattacaagaaattg
gaatctactaaatcctggctctctaatgtagtcaaaactgtttcggattaa

DBGET integrated database retrieval system