KEGG   Tolumonas auensis: Tola_0194
Entry
Tola_0194         CDS       T00904                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tau02044]
    Tola_0194
Secretion system [BR:tau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Tola_0194
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACQ91824
UniProt: C4L825
Position
213691..214185
AA seq 164 aa
MSGKEGSVAPKERINVTFKPSTGEGMEELELPLKLMMIGDYTLTKDDRKLEDRKAININK
NNFNEVLENQNIGLDLQVPNRLSNHDVNEEIALSLRFKTLKDFDPANLVQQVPEMKALME
LRDALVALKGPLGNVPSFRKAIEEVLTNQDAREKVLAELGMVEK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcgggaaaagaaggctctgttgcaccgaaagagcggattaatgtcaccttcaaacca
tctactggtgaagggatggaagagcttgagttgccacttaagttaatgatgattggtgat
tacactctgacaaaagatgatcgcaaacttgaagatcgtaaagccattaatatcaataag
aacaatttcaatgaggtactggaaaatcagaatattggtttagatctgcaagttccgaat
cgtctgagtaaccatgatgtgaatgaagaaatagcacttagtttgcgtttcaaaacatta
aaagattttgacccggcgaatctggtacagcaagtaccagaaatgaaagctctaatggaa
ctccgtgatgccttagttgcactgaaagggccgttaggcaacgtaccatctttccgtaaa
gcaattgaagaagttttgaccaaccaggatgccagagaaaaagtgttggctgagttggga
atggttgaaaaataa

DBGET integrated database retrieval system