KEGG   Tolumonas auensis: Tola_0209
Entry
Tola_0209         CDS       T00904                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
tau  Tolumonas auensis
Pathway
tau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Tola_0209
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tau02044]
    Tola_0209
Secretion system [BR:tau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Tola_0209
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ACQ91839
UniProt: C4L8G9
Position
231934..234045
AA seq 703 aa
MFVSDSPDDALSSLGSSVRGLFSANESRFFLTLSGHDEDVQVLRFTAQESLNCPWELDIT
LVSEAENISPEKMVGSAATLTLSGCAGRSYYHGQVWQFRRQTQGKRLTQYQLVMRPSLSW
LGLGRNQRIFQQKSVPDIIRLLLQEQHVASDQVQWKLSGTYTARDYCVQYGESDLQFITR
LLGEEGIHYHFAHDEGGSKLIFADHPSGWSTGLAAVPYKPGTGQAADEDTLQSFQVRHAV
SVNMISRRYFDLHKPLQLTDAEQKTSPAAGSPSLKRNDSAWRDHLNHYDYRSAEQQSISS
AQQIAERHLESLQRTRITAQGRGNLSQLRTGWLLPIRGHGRAEFNSQWLLTEVSLSGEQP
QVLEEFSGGQSSLSCQFSAVPWDTPWRPDFAPEKPLLCGIQTACVTGPAGEEIHTDELGR
IKVQFHWDREGKEDERTSCWIRVMHDWAGNGYGVVRLPRIGQEVQVSFEDGNPDKPLITG
CLHNGEQQTAWELPVHMTRSGIRTCSSPGGGGSNELRFEDKKGKEELRWQAEKDWDAKIL
SCSHTQINGAHESAIGGNDYREIEGEQHITLEADTQKEVGLNQHCTIHGSQEQHIEQKCL
IQAGQNVVWQSKNQAIYHAGTELTLQAGGSFIKLDPCGITLSGPMVTMNQGGSALSAGSE
SAALPHKPAGAHSAGIGKVPQAKAPEKVIKVAPEKDYRIVYSD
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgtttgtatcagatagcccggatgatgcgctgtccagcctcggcagtagtgtccgtggt
ttattcagcgctaatgaatcgcgcttttttcttaccctgagcggtcacgatgaagacgta
caggttttacgatttacggcgcaggaatcgttgaattgtccatgggagctggatattacg
ctggtcagcgaagcggaaaatatatcaccggagaaaatggtgggtagtgcggccacgtta
accttatcggggtgtgcaggcaggagttattaccacggtcaggtgtggcaattccggcgg
cagacacaaggtaaacgactgacacaatatcaactggtgatgcgtccttcgctgtcctgg
cttggactgggccggaatcagcgtattttccagcaaaaaagtgtgcccgatatcatcagg
ctacttctgcaggaacagcatgtcgccagcgatcaggtgcagtggaaattaagcggaaca
tatactgcccgcgattattgtgttcagtatggcgaaagcgatctgcaatttatcacgcgt
ttgctgggcgaagagggtatccattaccactttgcgcatgatgaaggtggcagcaagctg
atctttgctgatcatccatcaggctggagcaccgggcttgctgctgtaccgtataaacca
ggtacgggtcaggccgcagatgaggataccctgcaatcatttcaggtcagacatgctgtt
tcagtcaatatgatctcccggcgttattttgacctacataaaccacttcaactgaccgat
gcagaacagaaaacatcaccggcagcgggtagtccatccctgaaaaggaatgacagcgcc
tggcgtgatcacctgaatcactatgattaccgcagtgctgagcaacagagtatcagttcg
gcacaacagatcgctgaacgtcacctggaatcactgcagcgcacccgtatcaccgctcag
gggcgcggtaacctgtcacagctgcgtaccggttggttgttaccgatccgtggacatggt
cgggcggaattcaacagtcagtggctgcttactgaagtcagcttaagcggtgagcagccg
caagtgctggaggagttcagtggcgggcaatcaagtttgagctgtcagttcagtgctgtg
ccgtgggatacaccgtggcgacctgattttgcgccagaaaaaccgttgttgtgcggcata
caaacggcctgcgtgacgggccctgcaggtgaagagattcataccgacgagttggggcgc
atcaaggtgcagtttcactgggacagagaaggtaaagaggatgaacgcaccagctgctgg
atccgcgttatgcacgattgggccggcaatggttatggtgttgtgagattgccgcgtatt
ggtcaggaggtacaggtcagctttgaagacggcaatccggataaaccgctgataaccggt
tgtttgcataacggtgaacagcaaactgcatgggagttgcctgtccatatgacccgcagc
ggcatccggacctgctcaagcccgggtggtggtggttccaacgaactgcggtttgaagat
aaaaaaggcaaagaagaactgcgctggcaggcagaaaaagactgggatgccaaaatcctg
agctgcagccatacccaaatcaatggcgcacatgaaagcgctattggtggtaatgactat
cgggaaatagagggtgagcagcacatcaccttagaagctgatactcagaaagaagtcggt
ttaaaccagcactgcaccatccatggtagtcaggaacagcatattgaacaaaagtgcctg
attcaggcagggcaaaacgtagtctggcagagtaagaatcaggctatctaccatgccggg
acggaactgacgttacaggctggcggcagttttatcaaactcgatccatgtggcattaca
ttaagcggcccgatggtgacgatgaaccagggcggcagtgcattatctgcaggcagcgaa
tccgcagcattaccacataaaccggcaggagcacacagtgccggcatcggtaaggtgccg
caggcgaaagcgccggagaaagtgattaaagtagcgcctgagaaagattatcggatagtt
tattcggattag

DBGET integrated database retrieval system