KEGG   Tolumonas auensis: Tola_0407Help
Entry
Tola_0407         CDS       T00904                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
tau  Tolumonas auensis
Pathway
tau00010  Glycolysis / Gluconeogenesis
tau00030  Pentose phosphate pathway
tau00051  Fructose and mannose metabolism
tau00052  Galactose metabolism
tau00680  Methane metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01130  Biosynthesis of antibiotics
tau01200  Carbon metabolism
tau01230  Biosynthesis of amino acids
Module
tau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_0407
   00030 Pentose phosphate pathway
    Tola_0407
   00051 Fructose and mannose metabolism
    Tola_0407
   00052 Galactose metabolism
    Tola_0407
  Energy metabolism
   00680 Methane metabolism
    Tola_0407
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tola_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase TCRP1
Motif
Other DBs
NCBI-ProteinID: ACQ92036
UniProt: C4L9D7
Position
complement(459267..460199)
Genome map
AA seq 310 aa AA seqDB search
MPLIVTLTLTPSLDTATSTAKVYPEGKLRCQAPVFEPGGGGINVARAITHLGGQATALLP
SGGPTGAHLVELLQQEGVTVDALQTHDWTRQNLHVVSDATGEQFRFVMPGAALHEDEWQQ
LLTKIAQLPAGTLLVLSGSLPPNMTTSAVTELLQCARQQGLRTIVDSSGDALKAAVAFGG
LELLKPNQSELAELTGQSLEQPDQVVNAARSLISQGAAKRIVVSLGPQGALAVDAEQCIQ
VVPPPVIKRSTVGAGDSMVGAMVLKLAEDAPLADMVRFGVAAGTAATMNQGTKLCSKDDT
EKLYQYLQQQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgattgtgactctcacactgaccccgtcactggacaccgccaccagcacagcc
aaagtctacccggaaggaaaattgcgctgccaggcaccggtgtttgaacccggtggtggc
ggcatcaacgtcgcccgtgccatcacacacctcggcggacaagccacagccctgctcccc
tccggtggcccaaccggtgcccatctggttgaactgctgcagcaggaaggcgttaccgtg
gatgcactgcagacccatgactggacccggcagaacctgcatgtggtctccgacgccacc
ggtgaacagttccgctttgtgatgccgggtgcggcattgcatgaagatgaatggcagcaa
ttgctgacgaaaatagcccaattaccggccggaacgttactggtgttgagcggcagtttg
ccgccgaatatgacgacatccgccgtgacggaactgctgcagtgtgcccggcaacagggg
ctgcggacgatcgttgacagctccggtgacgccttaaaagcggcggtcgcttttggtggt
ctggaactgttaaaacccaatcagtccgaactggcagaactgaccggtcagtcgctggaa
cagcctgatcaggtggtgaatgcggcccgttcgctgattagtcagggggcggcaaaacgc
attgtcgtctcgctgggtccgcagggtgcgctggctgtggatgcggaacaatgcatccag
gtagtgccaccgccggtgattaaacgcagcacggtcggtgccggtgacagtatggtcggc
gccatggtgctgaaactggcagaagatgcgccactggcggatatggtgcgctttggcgtt
gccgccggtacggctgcgaccatgaatcagggcaccaaactgtgcagcaaagatgatacc
gaaaaactgtatcagtatctgcaacagcaataa

DBGET integrated database retrieval system