KEGG   Tolumonas auensis: Tola_0940Help
Entry
Tola_0940         CDS       T00904                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tau  Tolumonas auensis
Pathway
tau00260  Glycine, serine and threonine metabolism
tau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01130  Biosynthesis of antibiotics
tau01230  Biosynthesis of amino acids
Module
tau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tola_0940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tola_0940
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tola_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-ProteinID: ACQ92568
UniProt: C4LC89
Position
complement(1020205..1021398)
Genome map
AA seq 397 aa AA seqDB search
MTLLDPFFGEFGGMYSPQILMPVLLELEKAFVDAKDDPEFQAEFQHLLTEYAGRPTPLTL
CRNLTKGTKTKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGAGQHGVATAL
ACALLDLPCRIYMGAVDCERQKPNVFRMRLMGAEVIPVHAGSSTLKDACNEAMRDWTANY
KDTHYILGTAAGPHPFPTIVREFQRMIGEEAKEQILKAEGRLPDAVVACVGGGSNAIGMF
ATFIEEEGVRLIGVEPAGHGIETGKHGAPIGHARKGIYLGMVSFLMQNEDGQVEESHSIS
AGLDFPSVGPQHAYLSSIGRAQYPSVTDQEALDAFQELSLREGIIPALESSHALAHALKM
ARSEPEKEQILIVNLSGRGDKDIFTVANALEGEGALS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttgatccattttttggtgaatttggcgggatgtactcccctcagatcctg
atgccagtgctgctggagctggaaaaagcgtttgttgatgccaaggatgacccggagttt
caggctgaatttcagcatctgctgacagaatatgcaggccgcccgaccccgttgacgctg
tgccgtaacctgaccaaaggcaccaagaccaaaatctatctaaagcgtgaagatctgctg
cacggtggtgctcacaaaaccaaccaggtattaggtcaggcgttgctggcaaaacgtatg
ggcaaaacccgcatcatcgccgaaaccggtgcgggtcagcatggtgttgctacggcgctg
gcatgcgcactgctggatctgccttgccggatctacatgggtgcagtggactgtgaacgc
cagaaaccaaacgtcttccgtatgcgtctgatgggtgccgaagttattcctgtgcatgca
ggttcttccaccctgaaggatgcctgtaatgaagcaatgcgtgactggactgctaactac
aaagatacccactacattctgggtaccgctgccggtccgcatcctttcccgactatcgtg
cgtgaattccagcggatgatcggcgaagaagccaaagaacaaattctgaaagcagaaggc
cgtctgccggatgcggtcgtagcctgtgtcggtggcggttcaaatgcaattggcatgttc
gcaactttcatcgaagaagaaggtgttcgtctgatcggcgttgaaccggcaggccacggt
attgaaaccggaaaacacggcgcaccaattggtcatgcccgtaaaggtatctatctgggc
atggtttctttcctgatgcagaatgaagacggccaggttgaagagtcacactcaatctct
gccggtctcgacttcccttctgtcggcccgcaacatgcctacctgtcatccatcggccgc
gcgcaatatccctcagtaaccgatcaggaagcgctggatgcgttccaggagctttccctc
cgtgaaggtatcatcccggcactggaatcctctcatgcactggctcacgctctgaagatg
gctcgttctgagccggaaaaagaacagatcctgatcgtgaacttatccggtcgcggagat
aaagacatatttactgtagccaacgcgctggaaggtgaaggagcactgtcatga

DBGET integrated database retrieval system