KEGG   Tolumonas auensis: Tola_1116Help
Entry
Tola_1116         CDS       T00904                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tau  Tolumonas auensis
Pathway
tau00790  Folate biosynthesis
tau01100  Metabolic pathways
Module
tau_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tola_1116
Enzymes [BR:tau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tola_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACQ92742
UniProt: C4LDE6
Position
complement(1218598..1219248)
Genome map
AA seq 216 aa AA seqDB search
MTHLSKEAVIVRSALEAKGLETPMQHSSLSAQEKKQQIEQHMTSIMTLLGLDLADDSLAE
TPHRIAKMYVDEIFSGLDYGSFPKITLIENKMGTDEMIKVQDIGLTSTCEHHFVTIDGKA
TVAYIPKDKIIGLSKINRIVNFFAKRPQVQERLTQQILVALQVLLGTDNVAITVTATHYC
VKSRGVMDASSQTTTTALGGVFKSSAATRHEFLSRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactcacctaagcaaagaagccgtaattgttcgttctgctctggaagcaaaaggcctg
gaaacgccgatgcagcattcatccctttctgcccaagaaaagaaacagcagattgagcag
catatgacatcaattatgacactgcttggtcttgacctggctgacgacagccttgcagaa
acaccgcatcggatcgccaagatgtatgtggatgagatattttccggacttgattacggt
tcattcccgaaaattaccctgattgaaaacaagatgggtactgatgagatgataaaagtg
caggatattggtttaaccagtacctgcgaacaccatttcgttactatcgatggaaaagcg
acggtggcttatattccgaaagataaaattatcggattatccaaaatcaaccggattgta
aacttcttcgcgaaacgccctcaggtgcaggaacggctgacacaacagatcctggttgcg
ttgcaggtcctgttaggtaccgataatgtcgctattaccgtgaccgcaacccactactgc
gttaaatcgcggggggttatggatgcatcaagtcaaaccaccaccaccgctctgggtggt
gtattcaaaagcagcgctgctacacgtcacgaattcctcagccgcgcctga

DBGET integrated database retrieval system