KEGG   Tolumonas auensis: Tola_1250Help
Entry
Tola_1250         CDS       T00904                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
tau  Tolumonas auensis
Pathway
tau00270  Cysteine and methionine metabolism
tau00480  Glutathione metabolism
tau01100  Metabolic pathways
Module
tau_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tola_1250
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tola_1250
Enzymes [BR:tau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Tola_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST SpoU_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACQ92867
UniProt: C4LE46
Position
complement(1362396..1363352)
Genome map
AA seq 318 aa AA seqDB search
MSIKLGIVMDPIQSINIKKDTSFAMLLEAQQRGYELYYMEMSDLYLEQGISYATMRPLEV
RQDYTCWYSLGEVVDQPLHELDVILMRKDPPFDTEFIYATYLLERAEDQGTLIVNKPQSL
RDANEKLFTAWFAEHTPTTLVTRSAAKLRSFHQQHQDVILKPLDGMGGASIFRMKHDDPN
IGVIIETLTEHGSRYCMAQTYLPAIKDGDKRVLVVDGEPIPYCLARIPSQGETRGNLAAG
GRGEPRELTEADWKIARAVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEFDI
NICGLLMDAIERRLAKTS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaattaggcatcgtgatggaccctattcagtccatcaatatcaagaaagac
accagttttgccatgttattggaagctcagcaacgtggttacgaactctattacatggag
atgagtgatctctatctggagcagggtatttcttatgctaccatgcgcccgctggaagtc
cgccaggattacacctgctggtattcactcggtgaagttgttgatcagccgttgcatgag
ctggatgtgatcctgatgcgtaaggatccgccgtttgataccgaattcatttatgcgacc
tatctgctggaacgcgcggaagaccaaggcacattaatcgttaacaaaccgcaaagtctg
cgtgatgccaacgaaaaactgttcaccgcctggtttgctgagcatacgcccactacgctg
gtgacacgctctgccgccaagttacgttcattccaccagcagcatcaggatgtgatcctg
aaaccactggatggaatgggtggtgcatccatattccgcatgaaacatgatgatcccaac
attggggtaatcatcgaaacactgactgaacatggctcccgctattgcatggcgcagact
tacctgccggcgattaaagatggcgataagcgtgtattagtcgtcgatggcgagccgatc
ccttattgcctggcccgtatcccgtcgcagggtgaaacccgcgggaatctcgccgctggc
ggacgtggcgaaccacgcgagctaaccgaagctgactggaaaattgcccgtgcggtgggc
ccgacactgaaagcgaaaggcctgatttttgttggtttagatattatcggtgatcgtctc
actgaaattaacgtaaccagcccgacttgtgtccgggaaattgaagccgaatttgatatc
aatatttgtggtttgctgatggatgcaatagagcgccgtctggctaaaaccagttaa

DBGET integrated database retrieval system