KEGG   Tolumonas auensis: Tola_1578Help
Entry
Tola_1578         CDS       T00904                                 

Definition
(GenBank) ABC transporter related
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
tau  Tolumonas auensis
Pathway
tau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Tola_1578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_1578
Enzymes [BR:tau01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     Tola_1578
Transporters [BR:tau02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Tola_1578
   Histidine transporter
    Tola_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_15 ABC_ATPase AAA_29 AAA_16 PRK Mg_chelatase G-alpha AAA_33 AAA_23 RsgA_GTPase AAA_24 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACQ93189
UniProt: C4LF22
Position
complement(1744495..1745268)
Genome map
AA seq 257 aa AA seqDB search
MHNYKLAVNDLHKKYGQHEVIKGVSLCAKAGDVISIIGSSGSGKSTFLRCLNFLEKPSAG
SIFVNGKEIHMTMDSDGQLNVVDQKELQLLRTKLTMVFQHFNLWSHMTVLENVMAAPIKV
LGMDKEEAKAKAIQYLEKVGIDERARAKYPAHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLKIMQKLAEEGKTMVVVTHEMGFARNVSNHVIFLHQGKIEEEGHPDDVL
GNPKSERLKQFLSGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcacaattacaaattggctgtaaacgatctgcataaaaaatatggccagcatgaagtt
attaaaggtgtgtctttatgcgcaaaggccggtgatgtgatcagtatcatcggttcatcc
ggttcaggtaaaagtacttttttacgttgcctgaattttctggagaaaccgagtgccggt
tccattttcgttaatggtaaagaaatccatatgacgatggattccgatggtcagctaaac
gttgtcgatcaaaaagagctgcagttactccggaccaaactaacgatggttttccagcac
tttaacttgtggagccatatgacggttttagaaaacgttatggctgcgccgatcaaagta
ttagggatggataaagaagaagcaaaagccaaggccattcagtatctggaaaaagtgggt
attgatgaaagagccagagccaagtatccggcgcatttatcaggtggacaacaacagcgt
gtatccattgcccgtgcattagcgatggagccggaagtactgctgtttgatgaaccgact
tcagcgttagatccggaactggttggcgaagtgctgaagatcatgcaaaagcttgcggaa
gaaggcaaaaccatggtggtcgtaacccatgaaatggggttcgcccggaatgtttcgaat
cacgtgattttcctgcatcaggggaaaattgaagaagaaggccatccggatgatgtacta
ggtaatccgaaaagtgagcgtctgaaacagtttctatccggttcgctgaagtaa

DBGET integrated database retrieval system