KEGG   Tolumonas auensis: Tola_2124Help
Entry
Tola_2124         CDS       T00904                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
tau  Tolumonas auensis
Pathway
tau00052  Galactose metabolism
tau00561  Glycerolipid metabolism
tau00600  Sphingolipid metabolism
tau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tola_2124
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tola_2124
   00600 Sphingolipid metabolism
    Tola_2124
Enzymes [BR:tau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tola_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: ACQ93723
UniProt: C4L877
Position
complement(2325030..2326346)
Genome map
AA seq 438 aa AA seqDB search
MKVAIIGAGSTVFMRNIVRDLLQQPALTSTHIALQDIDSKRLQESQLVARQIISALKVPA
TVSASLDRREVLQGANVVITMFQVGGYKPSTVVDFDIPKKYGLRQTIADTLGIGGIMRGL
RTVPVLVDVAREMRELCPNALLMNYVNPMAILSLAVQRMVPEIQYVGLCHSVQGTAEELA
HDLGVEPANLVYTCAGINHMAFYNQFTQRLPDGSTEDLYPRLKALAAEGKVPDGNRVRYE
ILRKFGYFVTESSEHFAEYSPWFIKRDRPDLIEKFNIPLDEYPRRCEKQMADWAAELQRI
ETQHDIEIKQSREYAASIINSLATGEPSVIYGNVLNNGLIDNLPQDCAVEVACLVDRNGV
QPVKFGNVQPQLAALMRTNVNVQQLTVEALMTENPEYIYHAAYLDPHTSAELDLDQIHDL
VDDLRRAHGDWLPKFARL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgctattatcggtgccggcagcacggtgttcatgcgtaatatcgtgcgcgat
ttgctgcagcaacctgccttaacatccacccatattgctttgcaggatatcgacagcaaa
cgccttcaggaatcacaactggtcgcccgacagatcatttccgcgctgaaggttccggct
acggtaagcgccagtctggatcgccgtgaagtattacagggcgcgaatgtggttatcacc
atgtttcaggttggcggttataaacccagtacggttgttgattttgatattccgaaaaaa
tacggtttacgtcagaccatcgcggatacattaggcattggcggtatcatgcgtggctta
cgtacggtgccggtactggtggatgttgcccgtgagatgcgggaattgtgccccaatgcg
ttgctgatgaactacgttaacccgatggcgatcttaagtctggcggtacaacgtatggtg
ccggaaatccagtatgtcggtctgtgccattctgtgcagggaacggcggaagaattggcg
catgatctgggtgttgagccagcgaatctggtttacacctgtgccggtatcaaccatatg
gcgttttataaccaatttacgcagcgtctgccggatggctcaacagaagatctctatccg
cgtctgaaagcgctggcggcggaaggtaaagtgccggatggtaaccgggtacggtatgaa
attctgcgtaaattcggttatttcgtaacggaatcgagcgaacattttgccgaatattca
ccgtggtttattaaacgggatcgtcccgatctgatcgagaaattcaatattccgctggat
gaatatccgcgccgctgtgaaaaacagatggcggattgggcggcagagctgcagcgcatc
gaaacgcagcatgacatcgaaatcaagcagagtcgtgaatatgctgcctccatcatcaac
tcgctggcgaccggtgaaccatccgtcatttacggtaacgtgctgaacaacgggttgatc
gataatctgccgcaggattgtgcggtcgaggtggcttgtctggtggatcgcaacggtgtg
caaccggtgaaattcggcaacgtacaaccacaactggcagcgttaatgcgcaccaacgtc
aatgtacagcagctgacagtggaagcattgatgacggaaaatccggaatatatttatcat
gccgcttacctggatccgcataccagtgccgaactggatttagatcagatccatgatctg
gtcgatgacttgcgccgtgcgcacggtgactggttacctaaatttgcacgtctgtaa

DBGET integrated database retrieval system