KEGG   Tolumonas auensis: Tola_2414
Entry
Tola_2414         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94009
UniProt: C4L9Q6
Position
2639494..2640237
AA seq 247 aa
MDHSSNPFARGYYGFEIRRLAVISYDERHPQTFLPLHPSQAHLPDDKVAYQACIFNDDFV
LITEGQTVPAELDALCGGSGAVQAVYHSIYGRTLDRGFIHVGDSYTLEYAQAVVRNLQFE
TGFYSRAWEISTAHITEASGRYLCELADIATPSGFLFVAFRIPYSPAIGVKLIATPWTDE
NLMHVEGITAEQLRREHLSKGMPEDLADVLALAGQADVRVLVFDADANELDGLTVFEEED
DTPSVDT
NT seq 744 nt   +upstreamnt  +downstreamnt
atggaccattcatccaatcctttcgcccgcggctactacggtttcgagattcggcgcctt
gccgtcatcagctacgacgagcgccacccgcaaacctttctgccgctgcatccatcgcag
gctcatctacccgatgacaaggtggcgtaccaagcgtgcatcttcaacgatgatttcgtg
ctgatcaccgaaggccaaacggtgcccgccgaactcgatgccttgtgcggcggcagcggc
gccgtgcaggccgtgtaccacagcatctatggccgaaccctcgatagaggcttcatccat
gtgggcgacagctacacactggaatatgcccaagcggtggtgcgcaatctgcagttcgag
acgggcttctacagccgtgcctgggagatcagcacggcccacatcaccgaagcatcgggc
cgctacctgtgcgaactggcggatatcgccacaccgagcgggttcctgttcgtcgccttt
cgcatcccgtacagcccagccatcggcgtcaagctgatcgccacaccctggacggatgag
aacctgatgcacgtcgaaggcatcaccgccgagcaactgcgccgggagcacctgtccaag
ggcatgcccgaggatctggccgacgtactggcgctggccggacaggctgacgtcagggtg
ctggtattcgatgctgatgccaacgagctggacggtctgaccgtcttcgaggaagaggac
gacaccccctctgtggacacctga

DBGET integrated database retrieval system