KEGG   Tolumonas auensis: Tola_2415
Entry
Tola_2415         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94010
UniProt: C4L9Q7
Position
2640529..2641341
AA seq 270 aa
MDHQLIRQQLPTLVSGHVPSNARGFKFVIFDGEPKVSTMGFHIDPKPFEGKVIASTDEAI
VVKTGRTQFMVLDRSRVTEEPDEGAKVQVEPYARRRFDGLRADTPEERTEYTHDGQPYKL
QTFVLGSAPAKLPVPQPRCLELQQLIEQLETLPAPDGYRRITHLLVDAGACDFTWVDPLP
KDIIATPPAISFNVVTAKFQGRVTVLYERGDDLYAVELHRDGELVERVDEVFFDDLGNTL
ERLIDDGSWRQIRVSTVQKPARRKPRAVSA
NT seq 813 nt   +upstreamnt  +downstreamnt
atggaccatcaactcattcgtcaacaactcccgacgctggtttccggccatgtgccgtcc
aatgcccgcggcttcaagttcgtcatcttcgacggtgagcccaaggtatcgacgatgggc
ttccatatcgatcccaagccttttgaaggcaaggtcatcgcgagcacagacgaggccatt
gtcgtcaagaccggacgcacccagttcatggtgctcgaccggtcgcgcgtgaccgaggaa
cccgacgaaggtgccaaggtacaggtcgagccttatgccagacgccgcttcgacggcttg
cgggcggatacccccgaggaacgcaccgagtacacccacgacggccagccctacaagctg
cagacgttcgtgctcggttcggctccggcgaaactgccggtcccgcagccgcgctgcctg
gaactgcagcaactcatcgagcagttggaaacgctgccggcgcccgacggctaccggcgc
atcacgcacctgttggtcgatgctggcgcgtgcgacttcacttgggtcgatccactgccc
aaggacatcatcgccacgccgccggccatcagtttcaacgtggtcactgcgaagttccag
gggcgcgtcaccgtgctgtacgaacgaggcgacgatctctatgcggtggaactgcaccgc
gacggtgagctggtggagcgcgtggatgaggtgttcttcgatgacctcggcaacacgttg
gaacgcctgatcgacgatggcagttggcgccagattcgcgtcagcaccgtgcagaagccc
gcacggcgcaagccgcgggcggtatccgcatga

DBGET integrated database retrieval system