KEGG   Tolumonas auensis: Tola_2417
Entry
Tola_2417         CDS       T00904                                 

Definition
(GenBank) protein of unknown function DUF932
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF932
Other DBs
NCBI-ProteinID: ACQ94012
UniProt: C4L9Q9
Position
2643003..2643830
AA seq 275 aa
MSLASRFAPRSPVLRSDRPLLDDQIRAVVPSIFAETPHESRSQRYSYIPTATVLSELRQE
GFLPFMVCQTRVRNEDRREYTKHLIRLRHASQINGDEANEIILLNSHDGTSSYQMLAGQF
RFVCQNGLVCGDTFADIRVPHKGDVAGQVIEGAYEVLKGFERVQEARESMRAITLEAGED
DVFARSALALKYDDPDKPAPVTESQLLVPRRWDDRKSDLWSIFNRVQENLVKGGLTGRTA
NGRRQRTRPVQGIDQNLRLNRALWMLAEGMRQLKS
NT seq 828 nt   +upstreamnt  +downstreamnt
atgtctctcgcatcccgtttcgcaccgcgctcaccggtactgcgctcggaccgtcctctg
ttggacgaccagattcgcgccgtggtgccgtcgatctttgcggaaacaccgcacgaaagc
cgttcccagcggtacagctacatcccgacggccaccgtgctgtcggaacttcgtcaggag
ggattcctgcccttcatggtgtgccaaacacgtgtccgcaacgaggaccgccgcgagtac
accaaacacctgatccgccttcgccacgccagccagatcaatggcgacgaagccaacgag
atcatcttgttgaactcgcacgatggcaccagcagctatcagatgctggcaggtcagttt
cgattcgtctgccagaacgggctggtctgcggcgacacgttcgcggacatccgcgtgcct
cacaagggcgatgtcgcgggccaggtcatcgaaggtgcctacgaagtcctgaaaggcttc
gagcgggtgcaggaagcgcgcgagagcatgcgcgcgatcacgctggaggctggggaggac
gacgttttcgcccgttcggccctggcgctcaagtacgacgatccggacaagcccgcgcct
gtcacggagagtcagttgttggttcccagacgctgggacgatcgcaagagcgacctctgg
tcgatcttcaaccgcgtccaggaaaacctcgtcaagggagggctgaccggacgcactgcg
aacggccgccgccagcgtacccgccctgtacagggtatcgatcagaacctgcgcctgaac
cgcgccctctggatgctcgccgaaggcatgcgccagttgaagtcctga

DBGET integrated database retrieval system