KEGG   Tolumonas auensis: Tola_2418
Entry
Tola_2418         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF3275
Other DBs
NCBI-ProteinID: ACQ94013
UniProt: C4L9R0
Position
2643929..2644621
AA seq 230 aa
MATAAVQSDPPLIVRGQLAIRTIPGRNGRFTVGRLTTRLGLFHVKDPELEQYPEGKYEGE
FVIRYIYPKAYPVGDGMRFEIRANLDGMTLSGIDKLSKAEARAFAAQDVDPLDEELGTPP
ATTPAAAEKSKSRSKPEPAPVQASKDPLVDTTPFGVDTPSATVAASGGPESDDAALFGIL
WPLEESVKLDSTIDRRTLRLQIARLNQLGYAFDATAQQWNLQLAPEPQAA
NT seq 693 nt   +upstreamnt  +downstreamnt
atggctacagcagccgttcaatccgatccgcccctcatcgtccgcggccaactcgccatc
cgcaccatcccgggccgcaacggacggttcacggtcggtcgcctcacgacccgccttgga
ctgttccatgtgaaagacccggaactggagcagtaccccgaagggaagtacgagggtgag
ttcgtcatccgctacatctatccgaaggcctatccggttggcgatggcatgcgctttgaa
atccgcgccaacctggacggcatgaccctgtcgggcatcgacaagctgagcaaggccgag
gctcgcgccttcgccgcacaggacgtcgatccgctcgatgaagagctgggcacgccaccg
gcgacaacgccggcagcagccgagaaatccaagtcccggtccaagccggagcccgcgccc
gtgcaggcatcgaaagacccgctggtcgataccacgccattcggcgtcgatacgccgtcc
gccaccgtggccgcttcgggtggtcccgagagcgacgacgcggcgctgttcggcattctc
tggccgttggaagagtcggtgaaactcgactcgaccatcgatcgccgcaccctacgtctg
cagatcgcgcggctcaaccagttgggctatgccttcgacgccacggcccagcaatggaac
ctgcaactcgcacccgaaccgcaggctgcctga

DBGET integrated database retrieval system