KEGG   Tolumonas auensis: Tola_2419
Entry
Tola_2419         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94014
UniProt: C4L9R1
Position
2644711..2645052
AA seq 113 aa
MSRHYFDTFHKGFPVTVLLGWDRPMNYFFLVIEKPTELIDDTMKVESDDFLYSNLHESDP
FNHDLDYYREVLRHFQILVPESLFIEVQHDAERNVGNRVVKHQADGSFTEREL
NT seq 342 nt   +upstreamnt  +downstreamnt
atgagtcggcactacttcgacacattccacaaaggatttcccgtcaccgtactactcggc
tgggatcggccgatgaactacttcttcttggtcatcgagaagccaaccgagttgatcgac
gacaccatgaaggtcgagagcgacgacttcttgtacagcaatctgcacgagagcgatccg
ttcaaccatgacctggactactaccgtgaggtcttacgtcattttcagatccttgtgccg
gaaagcctgttcatcgaggtccagcacgacgctgagagaaatgtcggcaaccgcgtagtc
aagcatcaggccgacggttcgttcaccgaacgtgaactctga

DBGET integrated database retrieval system