KEGG   Tolumonas auensis: Tola_2420
Entry
Tola_2420         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94015
UniProt: C4L9R2
Position
2645136..2645792
AA seq 218 aa
MSAPSSPQLLYRIDECGDVMADACVCGEDGDLVFLSVWARDTAIQQFLARLTLGRDEDGL
DQFHLVTDQGGSVPVFVPSVERLEKRLTRSYRRTLFGSLVNLWLFDRRCIRPDKATTSAL
ALLPRAAADPTSRLWLLVKETCPLPLLDHWQGTVLALLRDRDMLRDLPTALGPLRGFRLG
LDVPALTEALSSLIRQGVLTAHPLPQPATTQGSLEAVA
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtctgcaccttcatccccacagttgctgtaccgcatcgacgaatgcggcgacgtgatg
gccgatgcttgcgtctgcggcgaagacggcgatctggtctttctatcggtctgggcgcgg
gacaccgcgatccagcagtttctcgcccggctcaccttgggccgcgacgaggatggactg
gaccagttccatctcgtcaccgaccagggcggctccgtgcccgtgttcgttccctcggtc
gagcgtctggaaaagcgcttgacccgcagctatcgccgcaccctgttcgggtcgctcgtc
aatctctggctgttcgatcggcgctgcatccggccggacaaggccaccaccagcgcgctc
gcactgttgccgcgcgcggcggccgatcctacgtcgcgcctctggctgctcgtcaaggag
acgtgcccgctgcccttgctggatcactggcaagggacggtgctggcactgctgcgagac
cgcgacatgctccgcgacctgccgacggccctcgggccgctgcgtggatttcgtctgggg
ctggatgtgccagcgctcaccgaagcactgagcagcctgatccgccagggcgtactgacc
gcccatccgctcccgcagccggcgaccacccaagggtcgctggaagcggtggcctga

DBGET integrated database retrieval system