KEGG   Tolumonas auensis: Tola_2421
Entry
Tola_2421         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: RNA_pol_Rpb6
Other DBs
NCBI-ProteinID: ACQ94016
UniProt: C4L9R3
Position
2645859..2646968
AA seq 369 aa
MALMFPRLARNFVKAGYFPTDEPTLERALSALASGDGPMCILDPCAGEGVAIAEAAHALG
RDQVTAYAVEFDPERANHARLLVDHCIQGDLMDTLIARQSFGLLWLNPPYGDLSKDANGN
IGYDGKGRARLEKLFYQRTLQLLQYDGILVFIVPHYVLDQELVGWLTRHFADLRIYRAVD
TQFKQVVVFGRRARQRELVGDEVKNARARLLQIGQGDLEAEELPPTWPSLPYVVPVAQHE
PEHFYRLSMEPAQFADEVQRLHGLWPSFETHLGAAQQSLRRPARALSQWHLALALAAGAI
SGVVQSKNGRTLAVKGDTYKQKATTTEYRERDDGSIAETRILTDKFVPVIRAWDLSPDSA
TLDRILTIH
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcactcatgttcccgcggctcgcccgcaatttcgtcaaggccggctactttccgacc
gacgaacccacgctcgaaagagcgctcagcgcactggcgtccggcgacgggccgatgtgc
atcctcgatccttgtgcaggcgaaggcgtcgccatcgcggaggctgcgcatgccctcggg
cgtgaccaggtcaccgcctatgcggtggagttcgacccggagcgcgccaaccatgcgcgt
ctgctcgtcgatcactgcatccagggcgacctcatggacaccctgatcgcacgccagagc
ttcggtttgctgtggctcaacccgccatacggggatctgtccaaagatgcgaacggcaac
atcggctacgacggcaagggccgcgcacggctggaaaagttgttctaccagcggacgctg
caactgctgcagtacgacggcatcctggttttcatcgtcccgcactacgtgctcgaccag
gagttggtcggctggctcacgcggcacttcgccgatctgcgcatctaccgtgcggtggat
acgcagttcaagcaagtcgtcgtgttcggtcgccgggcccgccagcgcgagctggtgggc
gatgaggtcaagaacgcccgtgcccgcctgttgcagatcgggcaaggcgacctggaagcg
gaggaactgccacccacgtggccgtcgcttccgtacgtggtccccgtcgcccagcacgag
ccggagcacttctaccgtctgagcatggagccggcgcagttcgccgacgaagtgcagcgc
ctgcatggcctgtggccgtcgttcgagacccatctgggcgccgcccagcagtccttgcgc
cgcccggcgcgcgcattgtcccagtggcacctggcactggccctcgcggccggcgcgatc
tccggtgtcgtgcagtcgaagaacggccgcaccctggccgtgaaaggcgacacctacaag
cagaaggcgacgaccaccgaatatcgcgagcgcgatgacggttcaatcgcagagacacgc
atcctcaccgacaagtttgtccccgtgattcgtgcctgggacttgtccccggactcggcc
accctcgaccggattctcaccatccactga

DBGET integrated database retrieval system