KEGG   Tolumonas auensis: Tola_2422
Entry
Tola_2422         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94017
UniProt: C4L9R4
Position
2647024..2647344
AA seq 106 aa
MLSRLFARREPQARPLFALGSLRLSEKVHWLASKGLIDPLPYVQRHVRGDWGDVDETTRQ
VNDVALDQDNPMISRYRITPQLLLIVMTSEDHRTTVVQLPEEQSSI
NT seq 321 nt   +upstreamnt  +downstreamnt
atgctttcgcgtttgttcgcgcggcgcgagccgcaagcccgtccgttgttcgccctcggt
tcgctgaggctgagcgagaaggtgcactggttggccagcaaaggcctcattgatcccttg
ccttatgtgcagcgccatgtgcgcggcgattggggcgatgtcgacgagaccacccgccag
gtcaatgatgtggcactcgaccaggacaatcccatgatctctcgctacaggatcacgccg
cagctgctgctgatcgtgatgaccagcgaggatcaccgcaccaccgtggtccaactgccc
gaagagcagtcctcgatctag

DBGET integrated database retrieval system