KEGG   Tolumonas auensis: Tola_2423
Entry
Tola_2423         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94018
UniProt: C4L9R5
Position
2647431..2647739
AA seq 102 aa
MATVMSISTAPNLRFSPGATVMTVGVANLVEQGRLNPSPYLRRHLSGDWGDLDEDDRRSN
DAALASGEARLLSSYQVDPDLKLWIITEWDRSVTTLLLPSEY
NT seq 309 nt   +upstreamnt  +downstreamnt
atggcaactgtaatgtccatcagcacggcccccaatctgcgcttctcgccgggcgcgacg
gtcatgaccgtcggcgtggccaatctggtcgaacagggacggctcaacccgagcccgtac
cttcgccgccacctcagcggcgactggggcgacctcgacgaggacgatcggcgatcgaac
gatgccgcgctggcatcgggcgaggcccggttgctctcttcgtaccaggtcgatcccgat
ctgaaactctggatcatcactgagtgggaccgcagcgtcacgacgctgttgttacccagc
gagtattga

DBGET integrated database retrieval system