KEGG   Tolumonas auensis: Tola_2424
Entry
Tola_2424         CDS       T00904                                 

Definition
(GenBank) helicase domain protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: ResIII Helicase_C SNF2_N AAA_30 DUF2075 CbiA TsaE
Other DBs
NCBI-ProteinID: ACQ94019
UniProt: C4L9R6
Position
2647836..2650121
AA seq 761 aa
MTMQLEAAPAAPSMPATGDLFKPADSESDLSFSLQDFVTEFGDELLDSLNRANPPVYNGV
PRANRQLVLASLKRQLFPAQAEVVHAAAELLVNQGERAAIVNGEMGTGKTTVGIALGAVL
NAEGYRRTLVLSPPHLVYKWRREILETVAGAKVWVLNGPDTLLKLIKLREQLNVPAEGQE
FFIIGRVRMRMGFHWKPAFVRKHTRYGMVGACPHCGTVVTDLDGEPVNALELEAEEIRRK
CNVCDGALWTLMRPRSLSGSDQSSAVLRALKRIPTIGEATANKLMKTFGDSFLASMLGDN
LHNFINLMDERGELVFSDRQAQRMERAMSSMEFGFGEGGYQPSEYVKRYLPQSTFDLLIA
DEAHEYKTGGSAQGQAMGVIAAKARKTVLLTGTLMGGYADDLFHLLFRALPARMIEDGYR
PSASGSMNAAAMAFMRDHGVLKDIYSESNGPAHKTAKGSKITVRTVKAPGFGPKGVLRCV
LPYTIFLKLRDIGGVLPPYDEEFREVAMDAGQADAYRNLAASLTAELKEALRKRDTTLLG
VVLNVLLAWSDCCFRAETVRHPRTRQVLAFTPAQFNELEIMPKERELIDICREEKAAGRK
TLVYSVYTGTRDTTSRLKMLLEQEGFRVAVLRASVDASRREDWIAEQLDRGIDVLITNPE
LVKTGLDLLEFPTIVFMQSGWNIYTLQQAARRSWRIGQKQHVKVIYLGYAATSQMTCLAL
MAKKILVSQSTSGDVPESGLDVLNQDGDSIEVALARQLVAA
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgaccatgcaactcgaagcggcccccgccgcaccttccatgcccgccacgggcgatctg
ttcaagcctgcggacagcgaaagcgatctgtctttcagcctgcaggatttcgtcaccgag
tttggggatgagttactcgactccctcaaccgggccaacccgcccgtttacaacggtgtg
ccgcgcgccaaccgccagctcgtcctcgccagcctcaagcggcagctgttccccgcccag
gccgaggtcgtccatgcggccgccgaactgctcgtcaatcagggcgagcgcgcggccatc
gtcaatggcgagatggggacggggaaaaccaccgtcggcatcgcgctaggggcggtgctc
aacgcggaaggctatcgccgcacgctcgtcctcagcccgccccatcttgtctacaaatgg
cggcgcgagatcctcgaaaccgtcgccggtgcgaaagtctgggtgctcaacggcccggac
acattgctcaagttgatcaagctgcgcgagcagttgaacgtgccggccgaagggcaggag
ttcttcatcatcggcagggtcagaatgcggatgggattccactggaagcccgccttcgtc
cgcaaacacacccgttacggcatggtcggcgcctgcccgcactgcgggacggtggtcact
gatctcgacggcgagccggtcaatgctctggagctggaggcggaagaaatccgccgcaag
tgcaatgtctgcgacggcgcactctggacgctgatgcggccgcgcagcctgtcgggcagt
gatcagtcctcggcggtgctgcgtgcgctgaagagaatcccgaccatcggcgaggccacg
gccaacaagctgatgaagaccttcggcgattcgttcctggcgtcgatgctcggcgacaac
ctgcacaacttcatcaacctgatggacgagcgcggggagttggtgttttccgaccggcag
gcgcagcgcatggaacgcgccatgtcctcaatggagttcggcttcggagaaggcggctat
cagccctcggaatatgtgaagcggtatctgccgcaaagcaccttcgacttgctcatcgca
gatgaagcccatgaatacaaaacgggtggatcggcgcagggccaggcgatgggcgtcatc
gcagccaaggcacgcaagaccgtactgctaaccggtaccctcatggggggctatgcagac
gatctctttcatttgctgttccgggccttgcccgcgaggatgatcgaagatggttaccgc
ccgagcgccagcggcagcatgaatgccgctgccatggcgtttatgagggaccatggtgtc
ctcaaggacatctattccgagagcaacgggccggcccacaagaccgccaaaggctcgaag
atcaccgtcagaacggtcaaggcacccgggttcgggccgaaaggcgtactgcgctgcgtg
ctgccgtacacgatcttcctcaagctcagagacatcggcggcgtgctgccgccgtatgac
gaagagttccgggaggtcgccatggatgccgggcaggccgacgcctaccgcaatctggcc
gccagcctgacggcggaactcaaggaggccctgcgcaagcgggataccaccttgctgggc
gtagtcctcaatgtgctgttggcgtggtccgactgctgcttccgggcagaaaccgtgcgc
cacccgcgtacgcgccaggtcctggccttcacaccggcccagttcaacgagctggagatc
atgccgaaagagcgtgagctgatcgacatctgccgcgaggagaaagccgcgggtcgtaag
accctggtgtactccgtctacaccggcacgcgcgataccaccagccgtttgaagatgttg
ctggagcaagagggttttcgggtggcggtactgcgcgcaagcgtggatgcctctcgccgc
gaagactggattgccgagcagctcgatcgcgggatcgacgtcctcatcacgaatccggaa
ctggtgaaaaccggcctggatttgctggagttccccacgattgtgttcatgcagtcgggg
tggaacatctacacgttgcaacaagccgcgcgccggtcatggcggatcggccagaagcag
catgtgaaggtgatctacctggggtatgcggccacgtcgcagatgacgtgcttggccctg
atggcgaagaagatcctggtatcgcagagcacctccggcgacgtcccggaatcggggctg
gatgtgctcaaccaggacggcgattcgatcgaggtcgccctggcccggcaactcgtcgcg
gcctga

DBGET integrated database retrieval system