KEGG   Tolumonas auensis: Tola_2425
Entry
Tola_2425         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06198  competence protein CoiA
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Tola_2425
SSDB
Motif
Pfam: CoiA Uma2
Other DBs
NCBI-ProteinID: ACQ94020
UniProt: C4L9R7
Position
2650255..2651031
AA seq 258 aa
MVMVIEAAYANGTGVANALRMSQAQWLGLQRNYHVGDLLMPCCNAPAVPKISANGHPFFA
HLSGACSTSEESQWHLAAKILVRSVLEDLGCRASVEVPGSSETSRWKADVWGERGEAKLA
IEIQRSYQSLRDYRTRQKKYRAEGIKALWLLRQERYSTLTRSMSKERLRTEFGGKFPPAG
HFGPCLADVPIAMLELEPTTTITGAGFFTASLPDLLEAVLSDRFLCVDGLWCIDNLDAMS
RAAQLARERAAAQRAADI
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcatggtgatcgaagcagcctacgcgaatggcactggcgtcgcgaatgcactgcgc
atgtcgcaggcccagtggctggggctgcaacggaactatcacgtcggcgatctgctaatg
ccatgctgcaatgctccagccgtccccaagatcagtgccaatggccatcctttcttcgcg
catctaagcggtgcctgcagcacttccgaagaaagccagtggcacctcgcggccaagata
ctggtgcgcagcgttttggaggatcttggttgccgagcctcggttgaggttccagggagc
agcgaaaccagccgctggaaagccgatgtctggggcgagcgtggcgaggccaagttggct
atcgagatccaaaggtcatatcagtcgctgcgtgactaccgtacccggcaaaagaaatat
cgggccgagggcatcaaggcgctttggttgctaagacaagagagatacagcactctcacg
aggagcatgagcaaggagcgactgcggaccgagttcggaggaaaattccctccagccggg
cacttcggcccatgtctcgcagatgtgcctatagcaatgctcgagttggagccgaccacc
acgatcacaggtgctggatttttcaccgccagtcttccggatttactcgaagcagtgctt
agtgatcgctttctttgcgtagatggtctttggtgcatcgacaacctagatgcgatgtct
cgtgccgcccaacttgcgcgcgaacgtgccgcagcccagcgcgcggcagatatttag

DBGET integrated database retrieval system