KEGG   Tolumonas auensis: Tola_2427
Entry
Tola_2427         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07459  putative ATP-dependent endonuclease of the OLD family
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Tola_2427
SSDB
Motif
Pfam: AAA_15 AAA_21 DUF2813 AAA_29 AAA_23 AAA_27 SMC_N BIV_Env
Other DBs
NCBI-ProteinID: ACQ94022
UniProt: C4L9R9
Position
complement(2652902..2654689)
AA seq 595 aa
MRISRVRLINFANFSDVDIKTGDSIVIVGENKVGKSNFIRGLQLILDPGLSERDRQLSIE
HFWDGLVEDKIGKIIEVSVDLTDFTDNPRLMAHLNDCVIDPGPPMTARLTYRFQPKAGLG
RAPESLKDYEYVIFGGNDPEMHVGSAFRRMLPIDVQVALRDAEKDLASWRNSPLRPLIED
LAESLDEDAREEIQNQVDDAQRELAGHAQVVATANRISERLISIAGEQHAVPVSLGLAPT
RVDALLRSLRLLIDNGIRGVGDASLGTANLIFLALKSLELDRLVSDGERDHTFFVVEEPE
AHLHPHVQRLVYRYFLGTGGDENEEDAPLTTILTTHSPHIASVTPIRSIVLLRHDVGAGK
TVAVSTANAPFTQRDEEDLQRYIDVTRGEIFFSRGVILVEGDAERFLVPAFAEALDIHLD
MLGITVCSVGGTNFTPYVKLLGPEGLDIPHVILTDYDPVNGKAPLVRRRLINLLDVVEDE
YDHSEMETDDVIELAEEFGYFVNENTLETELFAGGLAESMRDVIQQELPQLRQATREALQ
QWVDDLDQVDEERLLKLIERIGKGRFAQALARSVSEDTCPHYIRSALEHIRNAVA
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcggatctcacgcgttaggctgatcaatttcgccaatttttcggatgttgatataaag
actggcgatagcatcgttatcgttggtgagaataaagtcggaaaaagtaacttcattcgt
ggattacagctgattctcgacccaggattgtccgagcgtgaccggcaattgagcatagag
cacttctgggatggcctggttgaagacaagatcggtaaaatcatcgaagtctcggtggac
ttgaccgacttcactgataacccgcggttgatggctcatctcaacgattgtgtgattgat
ccaggcccacccatgacggcccgtctcacctatcgcttccagcccaaagccggactggga
cgcgctccggaatcgttgaaagactatgagtatgtgatctttggtggtaacgaccccgaa
atgcacgtcggtagtgcgtttcgccgcatgttgccaatagacgtccaggtggcactgcgt
gatgctgagaaggatctcgcgagttggcgcaattcaccattgagacccctcatcgaagat
cttgccgagtcgttggacgaagacgcccgtgaggagattcaaaatcaggttgacgacgca
cagcgggaactagctggccacgcccaagtggttgcgacggcgaaccggatcagcgagcgg
ttgatctccattgctggtgagcagcatgctgtgcctgtgtcgcttggactcgctccaact
cgggtggatgcgctgcttcgcagcttgcgattgttaattgacaatggaattcgcggcgtc
ggtgacgctagtctgggaaccgcgaacctgatcttcctggcattgaagagcctcgaactc
gaccgcctcgtgtctgacggagaacgtgaccatacattctttgtggttgaggagcccgaa
gcgcacctgcacccgcacgttcagcgccttgtctatcgttatttccttggcaccggaggg
gatgaaaacgaggaagatgctccgctaacaacgatccttacaactcactccccacacatt
gcaagcgttacgccgattagatccatcgttctgctacgtcatgacgtgggggcaggcaag
actgtcgccgtttcaactgcgaatgcgccgttcacacagagggatgaagaagatctacag
cgctacattgatgtcacgcgtggcgagattttcttttctcggggggtcattctggtcgaa
ggcgacgcagagcgtttcctggtccccgcgttcgctgaggcgcttgatatccacctcgat
atgcttgggattaccgtgtgctcggttggcggaactaacttcacgccgtatgtgaagctc
ctaggccctgaaggactggatattcctcatgtcatcctgacggactatgatccggtcaat
ggcaaggctccgctggttcgccggcgactgatcaatcttcttgacgtggttgaagacgag
tacgaccactcggagatggagacagatgacgtaattgagcttgccgaggagttcggatac
ttcgtgaacgagaacacactggaaacggagttgttcgccggtgggttggctgagtcgatg
cgggatgtaattcagcaggaattgccgcaactgaggcaagcaacccgagaagcattgcag
cagtgggtggatgacttagaccaggtcgatgaagaacggctgctgaagcttatcgaaaga
atcggaaagggacgattcgctcaggcccttgcacgctcagtgtccgaggatacttgcccg
cactacatccgttccgcgctggagcatatccgcaatgccgtcgcgtag

DBGET integrated database retrieval system