KEGG   Tolumonas auensis: Tola_2428
Entry
Tola_2428         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94023
UniProt: C4L9S0
Position
2654915..2655478
AA seq 187 aa
MPATQLLRRLTGSGLLITAVLSGGCATTAAPPVDPLVEEADTAPQSPELIPVVRYGRYTL
VELVPTAAQRDLLLQVIDVAMPADARATVGDGLRHALQRSGYQLCENAHAVIELYSLPLP
AAHLYLGPMTLRDALLTLAGPAWDVQVDDRARQICFVPAGEPSADPETDTPLAAPVQTFP
IVDGGQP
NT seq 564 nt   +upstreamnt  +downstreamnt
atgccagcaacccaacttctacggcgcctgaccggcagcggcctgctgatcaccgctgtg
ttgagcggcggctgcgccaccaccgccgcaccgcccgttgatcctcttgtcgaggaagcc
gacacagcgccgcagtcacctgaactgattccggtggtgcgctatggccgctacacgctc
gtggagcttgttcccaccgcggcccagcgtgacctgctgctgcaggtcatcgacgtggcg
atgccagcggatgccagagcgacggtgggcgacggcctgcgccacgcactccagcgcagc
ggctaccagctttgcgagaacgcccatgcggtgatcgagctgtattcgctgccgctgccg
gcggcgcacctgtatctggggccgatgacgctgcgcgacgcactgctcacgctcgccggg
ccggcctgggatgtacaggtcgatgacagggcgcgccagatctgcttcgttcctgccggc
gagccctccgcagatcccgagaccgacacgccactggccgcgccggtgcagacctttccc
atcgtcgacggaggccagccatga

DBGET integrated database retrieval system