KEGG   Tolumonas auensis: Tola_2430
Entry
Tola_2430         CDS       T00904                                 

Definition
(GenBank) putative secreted protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-ProteinID: ACQ94025
UniProt: C4L9S2
Position
2656147..2656875
AA seq 242 aa
MQRRALSMLFLLAALNAPAFAQQPATQSTPAQSSRVTPSQIDQARDERLARDWGLRGDEW
GRYRELMEGPLGIHSPNLDPLTALGIEARSDEERRRYAELQVQVEARRVEKLLAYQRAYD
EAWQRLHPDAQRVNLPDALPGGSAMTGSGRTAVFVRDGCAPCAQVVQRLQTANAEFDLYM
VGSRQDDARIREWAQRAQIDPARVRSGSITLNHDGGRWLALGLPGELPAVVRQVNGQWQR
QP
NT seq 729 nt   +upstreamnt  +downstreamnt
atgcaacgtcgcgcactttccatgctgttcctgttggccgcgctgaacgcaccggccttc
gcgcagcagcccgccacccagagcacacccgcacagtcttcccgtgtcacgccgagccag
atcgatcaggcacgcgatgaacgcctggcgcgggactgggggctgcgcggcgacgaatgg
ggacgctaccgcgaactgatggaagggccgctgggcatccattcacccaacctcgacccg
ctgaccgcactcggcatcgaagcccgctccgacgaggagcgacggcgctatgccgaactg
caagtgcaggtcgaagcgcgccgcgtggaaaagttgctggcgtatcaacgagcctacgac
gaagcctggcaacgcctgcatcccgacgcccagcgggtgaatctgcccgatgcgctgccg
ggcggcagtgcgatgaccggcagcggtcgtaccgccgtgttcgtccgggacggctgcgcg
ccgtgtgcccaggtcgtgcagcgtctgcagacggcgaacgccgagttcgacctgtacatg
gtcggcagccgccaggacgacgcgcgcatccgcgagtgggcccagcgcgcgcagatcgat
ccggcgcgcgtgcgcagcggctcgatcacgctcaaccacgacggtggccgctggctggcg
ctgggtttgcccggtgaactgcccgcggtggtgcgtcaggtgaacggccaatggcagcgc
cagccctga

DBGET integrated database retrieval system