KEGG   Tolumonas auensis: Tola_2431
Entry
Tola_2431         CDS       T00904                                 

Definition
(GenBank) Lytic transglycosylase catalytic
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: SLT Glucosaminidase KAAG1
Other DBs
NCBI-ProteinID: ACQ94026
UniProt: C4L9S3
Position
2656857..2657447
AA seq 196 aa
MAAPALMPTWPLRVLLAAALATGPVQAQEIPPPAYQLAAQRAGIPSTVLYAVALQESGVR
RDDRIVPWPWSLNVAGQSRRYATRAQACAGVRQALREVPPTRIDVGLGQINLGYQQHRYR
QPCDLLDPYDNLRIAADILKEQHTPGEDWLLAVGRYHRPAGGAPAARYRRSVSQYLQRVL
GPQQTAAHAPRQENSR
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcagcgccagccctgatgccgacgtggccgctgcgcgtgctgctggccgccgcgctg
gcgaccgggccagtccaggcccaggaaattccgccgcccgcctaccagttggcggcccag
cgcgccggcattccttcgacggtgctctatgccgtggcgctgcaggaaagcggcgtgcgc
cgggacgatcgcatcgtgccgtggccctggtcgctcaatgtcgccggccagtcgcgccgc
tacgccacgcgcgcgcaggcttgtgcgggcgtgcgccaggcgctgcgcgaggtgcccccc
acgcgcatcgacgtgggcttgggccagatcaacctcggctaccagcagcaccgctaccgc
cagccctgcgatctgctcgacccctacgacaacctgcgcatcgccgccgacatcctgaaa
gagcagcacacccccggcgaagactggctgctggcggtcgggcgttaccaccgaccggct
ggcggcgcgcccgcggcgcgttaccggcgcagcgtttcacaatacctccagcgcgtgctc
ggcccgcaacagaccgccgcacacgcgccccgccaggagaacagccgatga

DBGET integrated database retrieval system