KEGG   Tolumonas auensis: Tola_2432
Entry
Tola_2432         CDS       T00904                                 

Definition
(GenBank) putative secreted protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF2859 Trehalose_PPase HpcH_HpaI
Other DBs
NCBI-ProteinID: ACQ94027
UniProt: C4L9S4
Position
2657444..2657989
AA seq 181 aa
MTSSIRATHGLLVVMLATVPMSAVRATPPLIVVEDRGGASALPYYEALDLQPRATSQPLP
SIVIPEAPTAAVDETAMLPVRSARLTPGTVARRVIEAPGLQPFFLVGDDATSQAWLRQHA
DTLRQRNAWGLVVNVETAQALAQLRAIAPGLNLSPMSADDLAERLGLRHYPVLVTATGIE
Q
NT seq 546 nt   +upstreamnt  +downstreamnt
atgacctcatccatccgggccacgcacggccttcttgtcgtaatgctcgccaccgtgccg
atgagcgcggtgcgtgccacgccgcccctgatcgtggtggaagaccggggcggcgcttcc
gcgctgccgtactacgaagcgctcgacctgcagccgcgcgccacgagtcagccactcccc
tccatcgtcattcccgaggcaccaaccgccgctgtcgatgagacggccatgctgccggtg
cgcagtgccaggctcacgccgggaacggttgcccgccgtgtcatcgaggcccccggactg
caaccattcttcctggtcggtgacgatgcgacctctcaagcctggttgcgtcagcacgcc
gacacgctgcgccaacgcaacgcctggggcctggtggtcaatgtcgagacggcccaggcg
ctggcacaactgcgtgcaatcgcgcccggcctgaatctgtcgccgatgtccgccgacgat
ctggccgaacgcctgggcctgcggcattacccggtgctggtcacggccaccggcatcgag
caatga

DBGET integrated database retrieval system