KEGG   Tolumonas auensis: Tola_2434
Entry
Tola_2434         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF4400 Babuvirus_MP
Other DBs
NCBI-ProteinID: ACQ94029
UniProt: C4L9S6
Position
2660180..2660929
AA seq 249 aa
MSDPASTAQRQQQRRQGLIATAISLPLRLFGVLIASLMLSILIECVGMHLFWKDQGWRHA
QSMLQYELGHLSNHFTRSAIVQEPGRTAHRLVETGYEWVFVKTGLLDKMNDTAERARAPG
QGQSRDFRYFISQVYVWAERYLIAAAFITLTFMVRLLVLVLTLPLVLTAVFVGLVDGLVR
RDVRKFGAGRESGFVYHRAKASLLPLAILPWVIYLAMPVSVHPLLILLPSAALLGLAVSL
TAGSFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagcgacccggcatccactgcgcagcggcagcaacagcgccggcagggcctgatcgcc
actgcgatctccttgccgctgcgcctgttcggggtactgatcgcctcgctgatgctgtcg
atcctgatcgagtgcgtgggcatgcacctgttctggaaggaccagggctggcgccatgcg
caatcgatgctgcagtacgagctggggcatctgtcgaatcacttcacgcgcagcgccatc
gtgcaggagccagggcgcaccgcgcaccgtctggtggagacgggttacgagtgggtgttc
gtcaagaccgggctgctcgacaagatgaacgataccgcagaacgcgcccgcgcgccgggc
caaggacaatcccgtgatttccgctacttcatcagccaagtctatgtctgggccgagcgc
tatctgattgccgccgctttcatcaccttgacctttatggtgcgcctgctggttctggta
ttgacactgccgctggtgctcacggcagtgttcgtcggtctggtcgatggactggtgcgc
cgcgacgtgcgcaagttcggcgccggccgggaatcgggcttcgtctaccatcgcgcgaaa
gcctcgctactgccactggcgatactgccctgggtgatctacttggcgatgccggtctcg
gtgcatccactgctgattctgttacccagcgccgccttactgggactggctgtatctctg
actgcggggagcttcaaaaagtacctgtag

DBGET integrated database retrieval system