KEGG   Tolumonas auensis: Tola_2435
Entry
Tola_2435         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: HEPN_Apea
Other DBs
NCBI-ProteinID: ACQ94030
UniProt: C4L9S7
Position
complement(2660930..2662300)
AA seq 456 aa
MGLKAELKALVDELDQIHKGATPWSEEPGIPDFVTAENGMQRFFTRKAREALGQFSSTLH
QNRPQKSVKIESEAYQKVVRQTVADLHAAGELLGFDECDQGGLLPKLKLLIEERLASIAN
EHTHYFPAWTLGMERVSPFSLGPVTFLNRSDWIDSVDFPQYGKDHYLNQPEANHRWKEIL
KDALQNPNDGSSIEGLANAVYSAIVGCPALVKVTVRGYEREFSRKLARLVAKTALDAISL
GFGAPECFLQQALQDERLPPAGSDRLVETKGFLWLPGSSLGKRITSQPPERVRQALDDMT
SIIPAFAAILDGLLDPSSHPHPKLANRWATALDWFGEGNRESSDAIALAKLGTCLDVLCC
GGKNDGIREMVIHLTGTSSETQVVRGNRPRTLKQLVKDIYDHGRSQILHGTHYDRLESFA
AERQYATYLARIVLIECAVRLQHYGGSDEDKAFRTI
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggggttaaaggccgagctgaaagctctcgtagatgagttagatcaaatacacaagggg
gccacgccatggtccgaagaacctggaattcctgatttcgtcactgctgagaatggtatg
cagcggttcttcacaaggaaggcaagagaggcacttgggcaattctccagcaccctccat
cagaatcggccccagaagtcagtgaagattgagtctgaggcctatcaaaaggtagtccgt
cagaccgttgccgacttgcatgctgcgggtgagctcttaggatttgatgaatgcgatcag
ggcgggcttcttccaaaactgaagttactcattgaggaacgactcgcaagcatcgccaac
gagcacacgcactattttcctgcctggaccctgggcatggagagggtttctcctttctcc
ctcggcccggtgacattcttgaatagatccgactggatagattcggtcgacttccctcag
tacggaaaggatcactatctgaaccaaccagaggcgaaccaccgctggaaggaaattctc
aaggatgccttgcagaatcccaatgatggctcctccatcgaagggctggccaacgccgtc
tacagtgcgatcgtcggatgtccggccttggtcaaggtaacagtccgtggctatgagcgt
gaattctcacgcaagttggcgaggttggttgccaagacagcgcttgacgctatctctctt
ggctttggggcccccgagtgcttcttgcaacaggcgcttcaagacgagcgtctaccgcct
gccggtagcgatcgcctggtcgaaaccaaaggatttctgtggttgcccggaagctcgctt
gggaagcgtattacttcgcaacctcccgagcgagtaaggcaagcgttggatgacatgacg
tctattattccggcattcgcggcgatccttgatgggttgcttgatccatcgagtcacccg
catcccaagcttgccaatcgatgggctactgcgctggattggttcggcgaaggcaatcgt
gaatcaagtgatgccatagcgctggcgaagctcggaacctgcctagatgtactgtgctgc
ggtggcaagaacgatggtatccgtgaaatggtcatccatttaactggtacgagtagcgaa
actcaggtagtacggggcaaccgtcctcgcacactgaagcagttggtcaaggacatctat
gaccacggtcgatcgcagatactgcatggcacacactacgacaggctggaatcattcgcc
gcagagcgccagtatgccacctacctcgcacggatcgtgttgattgagtgcgcagtgcgg
ttacagcactatggtggttcagatgaagacaaggcgttcagaacaatatag

DBGET integrated database retrieval system