KEGG   Tolumonas auensis: Tola_2436
Entry
Tola_2436         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ACQ94031
UniProt: C4L9S8
Position
2662464..2662841
AA seq 125 aa
MVFSFPRHAAHRGVAALLLMALTASPPLAAHAGTPAQRQELAAALRQLDALERFVAQSAA
NTPITAGERYHFDYPRLLDDLARVRAGIQFHLAPSRAQPRDPAVLSGDYRNESAPDVFSA
PEAQP
NT seq 378 nt   +upstreamnt  +downstreamnt
atggtgttttcgtttccacgccacgccgcgcatcgcggcgtggccgccctgctgctgatg
gcgctgacggcgagcccgccgctggcggcccatgccggcacgccagcccaacgccaggag
ctggctgcggccctgcgccagctcgacgcgctggaacgcttcgtcgcacagagtgcggcg
aataccccgatcacagcgggcgagcgctaccacttcgactacccacgtctactcgatgac
ctcgcgcgcgtgcgcgccggcatccagttccacctcgcgccgtctcgcgcccagccacgc
gaccccgccgtactgagcggcgattaccgcaacgagtccgcccccgacgttttctcggca
ccggaggcccagccatga

DBGET integrated database retrieval system