KEGG   Tolumonas auensis: Tola_2437
Entry
Tola_2437         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF3262 DUF485
Other DBs
NCBI-ProteinID: ACQ94032
UniProt: C4L9S9
Position
2662838..2663071
AA seq 77 aa
MTSAQISAFQANSSIAPAAMATVIVGLVFAVLLLWGAWAIRTAYVGWAENQLNQRQFLGV
VVRFLAMYLVLTFFLLS
NT seq 234 nt   +upstreamnt  +downstreamnt
atgacctccgcgcagatcagcgccttccaggccaacagcagcatcgcacccgccgcgatg
gcgacggtgatcgtcggcctcgtgttcgcggtgctgctgctgtggggggcctgggccatt
cgcaccgcctacgtcggctgggcggaaaaccagctcaaccagcgtcagttcctcggcgtc
gtcgtgcgttttctcgcgatgtacctggtgctgacttttttcctcctctcctaa

DBGET integrated database retrieval system