KEGG   Tolumonas auensis: Tola_2438
Entry
Tola_2438         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF2976
Other DBs
NCBI-ProteinID: ACQ94033
UniProt: C4L9T0
Position
2663088..2663450
AA seq 120 aa
MKTAHFPRICLARRAALALSLTTLPALSFAQGLPQLENPSRGTGGGIMETIRNYGYDIVL
LVALLVVASMFIGVCYHAYGTYAEIHTGRKTWGQFGLTVAIGAVLLVIGIWLLTEATGIL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaaaccgctcatttcccccgcatctgtctcgcccggcgcgccgcgctggcactgagc
ctcaccacgctgcccgcgctgtcgttcgcacagggcctgccgcaactggagaatccgtcg
cgcggcaccggcggcgggatcatggagaccattcgcaactacggctacgacatcgtgctc
ctggtcgcactgctggtcgtggcgtcgatgttcattggcgtgtgctaccacgcctacggc
acctacgcggaaatccacacgggcaggaagacctggggccagttcggactcacggtagcc
atcggcgcggtgctgttggtcatcggtatctggctgctcaccgaagcgaccgggattctc
tga

DBGET integrated database retrieval system