KEGG   Tolumonas auensis: Tola_2439Help
Entry
Tola_2439         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 TraL PrgI
Motif
Other DBs
NCBI-ProteinID: ACQ94034
UniProt: C4L9T1
Position
2663461..2663859
Genome map
AA seq 132 aa AA seqDB search
MSEHQHIRADGTVMFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWLFSTI
AIAPTFIVLGIAFGVFIGGGILRRQKRGRPDTWLYRQLQWRIATRYPLMAGWIGGHALIT
RSGRWSNRRVAR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcatcagcacatccgtgcggacggcaccgtgatgttccttccgcaccggctc
aaccggcatcccgtggtggtgcgcggcctgacggcggacgagctgtggatctgctgcggc
ctgtccggcgcagccggattgctggtcggcgcgcccctgtcctggctgttctcgaccatc
gcgatcgcgcccaccttcatcgtgctgggtatcgccttcggcgtgttcatcggcggaggc
atcctgcgccgtcagaaacgcggcagacccgacacctggttgtaccgccaactgcaatgg
cgcatcgcgacccgctatccgttgatggccggctggatcggcgggcatgcactgatcacg
cgttcgggccgctggtcgaaccggagggtagcgcgatga

DBGET integrated database retrieval system