KEGG   Tolumonas auensis: Tola_2440
Entry
Tola_2440         CDS       T00904                                 

Definition
(GenBank) putative secreted protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACQ94035
UniProt: C4L9T2
Position
2663856..2664536
AA seq 226 aa
MSRFRNEVAHLQAHIKTLRLGAVALLLIALVMGGGWWSAPRDLTIHVPPDLRSGSTRPWW
DVPPESVYSFTFYVWQQLHRWPTNGEEDYARNLHALSPYFTPACRAFLQADYDYRRSTGE
LRQRVRGVYEIPGRGYGDNPTARVRTVSDRNWVVTLDLSADEYHGPEQVKRALVRYPLKV
ARSDVDPARNPFGLVLDCYDGAPQRIATPEPEPPARGGLGQQGDSP
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagccgcttccggaacgaagtcgcgcacctgcaagcgcacatcaaaaccctgcgcctg
ggcgctgttgcgctgctgctgatcgcgctggtgatgggcggcggctggtggagcgcgccc
cgcgacctgaccattcacgttccgcccgatctgcgctcgggcagcacccggccctggtgg
gacgtgccgccggagagcgtctattcattcactttttatgtgtggcagcaactgcaccgc
tggcccacgaatggcgaagaggactacgcgcgcaacctgcatgcgctatcgccgtacttc
acccccgcctgccgcgcctttctgcaggccgactatgactaccgccgttctacgggagag
ctgcgccagcgggtgcgtggcgtgtatgagatccccgggcgcggctacggcgacaacccg
accgcgcgcgtgcgcacggtctccgatcgcaactgggtggtgacgctcgatctcagcgcg
gacgagtaccacgggccggagcaggtcaagcgcgcgctggtgcgctacccgctcaaagtc
gcgcggtcggacgttgatcccgcgcgcaaccccttcggcctggttctcgactgctacgac
ggtgcgccgcagcgcatcgctacgcccgaaccggagccacctgctcgcggcggcctgggc
cagcaaggagactccccatga

DBGET integrated database retrieval system