KEGG   Tolumonas auensis: Tola_2441
Entry
Tola_2441         CDS       T00904                                 

Definition
(GenBank) putative secreted protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: ACQ94036
UniProt: C4L9T3
Position
2664533..2665435
AA seq 300 aa
MKTRLLVWLGMLACALVPMAHAVEILRWERLPLAVPLQVGEERIVFVDRNVRVGVPASVG
DRLRVQSAGGAVYLRASEPIEPTRLQLQDADSGALILLDIAAEPAKDGEPPLEPVRIVEG
NATPQRYGQAQESGTAAPSPDQARPPRRETPVAVVLTRYAAQNLYAPLRTVEPVPGVMRV
NLRRDLPLDTLLPTLPVRAEALAAWRLEDQWVTAVRLTHTGGGWIDLDPRALQGDFLTAT
FQHPTLGPRGTPEDTTVLYLVTRGRGLPQSLLPAIHRFDPAALLPQVAPGHDLKESGDAQ
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaagacccgccttctcgtctggctgggcatgctggcctgcgcgctcgtgcccatggcc
catgccgtggaaatcctgcgctgggagcgcctgcctctggccgtgccgctgcaggtcgga
gaggaacgcatcgtgttcgtggatcgcaatgtacgcgtcggcgttccggccagcgtcggc
gaccggctgcgcgtgcagagtgccggcggcgcggtctatctgcgcgccagcgaaccgatc
gagcccacgcgactgcaattgcaggatgctgacagcggcgcgctgatcctgctggacatc
gctgccgagccggccaaggacggcgagccgccgttggagccagtgcgcatcgtcgagggc
aacgccacgccgcagcgctacggccaggcacaggaatccggcaccgctgcaccatcccca
gatcaagcccgtccgccccggcgcgaaaccccggtggcagtggtgctgacccgctatgcg
gcccagaacctgtacgccccgctgcgcaccgtggagcccgtgcccggcgtcatgcgcgtg
aatctgcgccgcgacctgccgctcgataccttgctgccgaccctgcctgtacgcgccgag
gcgctggcggcatggcggctggaggatcagtgggtgaccgccgtgcggctgacccatacc
ggcggcggctggatcgatctcgatccgcgcgcgctgcaaggggactttctcaccgccacc
ttccagcatccgacgctcggtccgcgcggcacgccggaggacaccacggtgctgtatctg
gtcacgcgcggtcgcggcctgccgcagtcgctgctgccggccatccaccgcttcgacccg
gccgcactgttgccccaggtcgctcctggtcacgacctcaaggagtccggcgatgcgcag
taa

DBGET integrated database retrieval system