KEGG   Tolumonas auensis: Tola_2443
Entry
Tola_2443         CDS       T00904                                 

Definition
(GenBank) putative secreted protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: ACQ94038
UniProt: C4L9T5
Position
2666815..2667249
AA seq 144 aa
MHSNWIKPLLLAAAVAALAGCATSKEELMPHGGRTMQDIWHQAAGDGGSGQVARRQLLDA
RQSLRRPLTDADVQAAPAEQMRYTRTAANEIHHQFPRLLNPDLVMYVYPHLAGTDPVPVP
GYSTVFPLYQRVQYAMPGERTEAY
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcactcgaactggattaaaccgctgctgctggcggcggccgtggcggcgctggccggc
tgcgccaccagcaaggaagaattgatgccgcatggcggccgcacgatgcaggacatctgg
caccaggcggccggcgacggcggcagcggtcaggtggctcgccgccaactgctggacgcg
cgccagagcctgcgccggccgctgacggatgcggatgtacaggccgcgcccgccgagcag
atgcgctacacgcgtacggccgcgaacgaaatccatcaccagttcccgaggctgctgaat
ccagacctggtgatgtatgtgtatccgcatctggccggcaccgatcccgtgccggtgcca
ggctattcgactgttttccccttgtatcagcgcgtccagtacgcgatgccgggcgaacgc
acggaggcgtactga

DBGET integrated database retrieval system