KEGG   Tolumonas auensis: Tola_2445
Entry
Tola_2445         CDS       T00904                                 

Definition
(GenBank) DsbA-thioredoxin family protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Thioredoxin_4 DSBA Thioredoxin_2 DMRT-like DUF3357
Other DBs
NCBI-ProteinID: ACQ94040
UniProt: C4L9T7
Position
2670141..2670899
AA seq 252 aa
MPLHRSTNPPPAVRRRRCLHLLLCAVGLLAVLLFALLAVVLRDSPDAAPTPTTQHHPGGP
PWRHGQADARFVLTLFADLECPFCKAYYPSLKSWIDQHADVSLQWHHLPLAIHEPAASEL
ARVAECAGETGGHGAFFDAVGWLYQHTRGGGQGLPGGLRYPGLTPVLQRCLDSERPQLIV
RDQAEQGAHGGITATPSLRLEDRQTERSLLLQGPVEGDALLSAMDLLMGDVPDAAPARAA
GLSAIDDGDMPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgcctctccatcgctcaacgaacccgccaccggctgtacgtcgtcggcgttgtctgcac
ctgttgctatgtgccgtcggcctgcttgcggtgctgctgttcgcgctgctcgccgtggtg
ctgcgcgacagtcccgatgccgcaccgaccccgaccactcagcaccacccgggcggtccg
ccgtggcgccacggccaggccgacgcccgtttcgtgctgacgttgtttgcagacctggaa
tgcccattctgcaaggcctactacccgagcctgaagagctggatcgaccagcatgccgac
gtcagtctgcaatggcatcacctgccgctggcgatacacgagccggccgcctcggaactg
gcacgtgtggccgagtgtgcgggcgagaccggcgggcacggggccttcttcgatgccgtc
ggctggctgtaccagcacacgcgcggcggcggccaggggctgcccggggggcttcgctac
ccagggctgacaccggtgctccagcgctgcctggatagcgagcgtccccagctcatcgtg
cgcgatcaggccgagcaaggcgcgcacggcggcatcaccgccactcccagcctgcgcctg
gaggaccgccagaccgagcgatcgctactcctgcaagggccggtcgaaggcgatgcgctg
ctgtccgccatggatcttctgatgggtgacgtgccggatgccgctccggctcgcgccgca
ggtttgtccgccatcgacgatggcgacatgcccaggtag

DBGET integrated database retrieval system