KEGG   Tolumonas auensis: Tola_2446
Entry
Tola_2446         CDS       T00904                                 

Definition
(GenBank) DNA repair protein RadC
  KO
K03630  DNA repair protein RadC
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Tola_2446
SSDB
Motif
Pfam: RadC Prok-JAB DUF2766 PA
Other DBs
NCBI-ProteinID: ACQ94041
UniProt: C4L9T8
Position
2671071..2671577
AA seq 168 aa
MTAVLSPDDSCIELNHDPVAVDEHEDRIIQQAIALLEQRIFRAGNALKKPNDACDFLRLM
LVGEPNEIFAALFLDTRHQVLAYEPLFRGTINQTSVYPRVVVQRALAANAAAVIFAHQHP
SGNSEPSAADRMITRRLRDALDLIDIRVLDHFIIGQGEPYSFAESGLL
NT seq 507 nt   +upstreamnt  +downstreamnt
atgactgctgtactttcccccgacgactcctgtatcgagttgaaccacgatcccgtcgcc
gtcgacgagcacgaagaccggatcattcaacaggccatcgcgctgctggagcaacgcatc
ttcagagccggcaacgccttgaagaagccgaacgacgcgtgtgactttctgcgtctgatg
ctcgtcggcgaacccaatgaaatcttcgccgcactgttcctcgacacgcgccaccaggtg
ctggcctacgagccgctgttccgcggcacgatcaaccagacatcagtctatccccgggta
gtcgtccagcgtgcgctggcggccaatgccgccgccgtcatcttcgcgcaccagcaccct
tcggggaactcagagcccagtgccgccgatcgcatgatcacccgccggctcagggatgcc
ttggatctgatcgacatccgtgtgctggatcatttcatcatcggccagggcgaaccgtac
tcctttgccgagagcggcttgctgtag

DBGET integrated database retrieval system