KEGG   Tolumonas auensis: Tola_2447
Entry
Tola_2447         CDS       T00904                                 

Definition
(GenBank) protein of unknown function DUF1525
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF1525 Thioredoxin_3
Other DBs
NCBI-ProteinID: ACQ94042
UniProt: C4L9T9
Position
2671713..2672213
AA seq 166 aa
MRIVRGGHLHHGFDYQGHSPRDAKSMHTFLAHLSRTLALPALLLVAGNVTAAEIWIVADV
RHPVAGAQAADRIIQLDAAQAIEAELSARLPDDPQRAAALVQRRLNEGGQALQQRMREAY
QGMTDAWSLGITSIPAVIVDQRYVVYGESDLGQALVRIERYREGQP
NT seq 501 nt   +upstreamnt  +downstreamnt
gtgcgcattgttcgtggtgggcatctgcaccatgggttcgactaccagggtcattcaccc
cgagacgcgaagtccatgcacacctttcttgcccacctcagccggacgctggcccttccg
gcactgctgctggtcgccggcaacgtgaccgcagcggagatctggatcgtggcggacgtc
cgccacccggtggccggtgcccaggcggcggatcgcatcatccagctcgacgcggcgcag
gccatcgaagcggaactgtcggcccggttgccggacgatccgcagcgggccgcggcgctc
gtccagcggcggctgaacgaaggtggccaagcgctgcaacagcgcatgcgtgaggcttac
cagggcatgaccgatgcctggagcttaggcatcaccagcattccggcggtgatcgtcgat
cagcgctacgtcgtgtatggggaaagcgacctcggccaggcgctggtccgcatcgagcgt
taccgggagggacagccatga

DBGET integrated database retrieval system