KEGG   Tolumonas auensis: Tola_2448
Entry
Tola_2448         CDS       T00904                                 

Definition
(GenBank) protein of unknown function DUF1527
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ACQ94043
UniProt: C4L9U0
Position
2672210..2673142
AA seq 310 aa
MISRRLRLGAAVALLCSATSSFALNTATIISSTLSPDCLEYRVTGICYWLYCTWTGCTVR
TSIKVRHYVPDAVVSSYSNTGENPWVEARAMSQPNATAQAGGDGTTNEDHENNLAKFKNA
DVIGHPGGEVFSQFASASGYICAGAGTAFMPYLLSTLDTLAWRYNVPEAVYPEALIPGMR
EIGTRSGLNLWGAVYPRGGFLHQTDDYKAGAVVAQRAGDIVTRRGQLHVYQPLLANARDG
YWPAGALIESDASTGKWQQLTPRLSNSCTVFPHAGSLPQAQRGDYAWALWRPYSCCQRRG
QTFLGSVDFN
NT seq 933 nt   +upstreamnt  +downstreamnt
atgatttcccgtcgcctgcggctcggggccgccgtcgcgctgctgtgcagtgccacgtcg
agcttcgccctcaacaccgccaccatcatctcctcgaccttgtcgccggactgcctcgaa
taccgggtcaccgggatctgctactggctgtattgcacctggacgggctgcaccgtgcgc
acgtcgatcaaggtacgccactacgttcccgacgcggtggtatcgagctacagcaacacc
ggggagaatccctgggtcgaggcgcgggcaatgagccagcccaatgccacggcgcaggcc
ggtggtgacggaaccaccaacgaggatcacgaaaacaatcttgcaaagttcaagaacgcc
gacgtcatcggccacccgggcggcgaggtattcagccagttcgcttcggcgtccggctac
atctgcgcaggcgccggtactgccttcatgccgtacctgctcagcacgctcgacaccctg
gcctggcgctacaacgtcccggaggcggtgtaccccgaggcgctgatccccggtatgcgc
gagatcggcacacgcagcggactgaatctttggggcgccgtgtacccgcgtggcgggttc
ttgcaccagaccgacgactacaaggccggggcggtcgtcgcccagcgtgctggcgacatc
gtgacccgccgcggccaactgcatgtgtaccagccgctgctggcgaacgcgcgcgacggc
tactggccggccggcgcgttgatcgaaagcgacgccagcacgggcaagtggcagcaactg
accccacgcctttccaacagctgcaccgtgtttccccatgccgggtcgctgccccaggca
caacggggcgactacgcctgggcgctgtggcgcccgtacagctgctgccagcgccgcggg
cagaccttccttggcagtgtggatttcaactga

DBGET integrated database retrieval system