KEGG   Tolumonas auensis: Tola_2449
Entry
Tola_2449         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94044
UniProt: C4L9U1
Position
2673153..2674550
AA seq 465 aa
MKRPDRRRHSMLADHLWRPAILAGALALASGWAWAQSGGFQTSGSVIGDEVMYSIGGGNA
VSMSGAAGMRSIGVGAGWNSNLICGDMSISTTIQNQLNGLTNGFQNIMSNVIQSATSAVA
SLPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRSMAERMADMAGGQLGWSQMAEGM
ALRDAVSSTDAVSAIEQAETRRGNDGVPWVGGNNAGGAGQPAIRVVSDVTRAGYNLVNGR
SVTDASAIDAASCNSLACQTWTSPQEAIDWATRVLGEQEQRTCDACTKTETVPGVGLTPL
IQEEYDTKLQTLQELIDGTRNTTFENLRDAGSVSLPITRGVIEALRDEPDQHVLAQRLAS
EVALASVLEKALLLQRTLLTGRKEPNVAANQLAVAAVDQESGALDREISNLKTELELRRT
LANNSPMAIIQRHSTRAAGSRGIYEGDPVPDRLDQLQRPNPGGTP
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaagcgccctgaccgtcgccgtcattccatgcttgcagatcacttgtggcggccggcc
atactggccggcgcgctcgcgttggccagtggctgggcatgggctcagagcggcggcttc
cagaccagcggcagcgtgatcggcgacgaagtcatgtactcgatcggtggcggtaacgcg
gtttccatgagcggcgctgcgggcatgcgctcgatcggggtcggggccggctggaacagc
aacctgatctgcggcgacatgagcatcagcaccacgatccagaaccagctcaacgggctg
accaacggatttcaaaacatcatgagcaacgtgatccagagcgctaccagcgccgttgcg
tcgcttccggctctgatcatccagagggccgacccaggtttgtataacctgctgaccaat
ggcgtcctccaggcaaggctggatttcgatcgctccaagttgacctgcaggtcgatggct
gaacgcatggccgacatggccggcggccagcttggctggagccagatggcggaaggcatg
gcgctgcgcgatgccgtgtcgagcacggatgcggtgtcggccattgagcaggctgagacg
cgccggggcaacgacggcgtgccgtgggtcgggggcaacaacgccggcggcgccggtcag
ccggcgatcagggtggtgagcgacgttaccagggccggctacaacctcgtcaatggccgc
agcgtgaccgacgcctcggccatcgatgcggcgagctgcaacagcctggcctgccagacc
tggacctccccgcaagaagcgatcgactgggccacccgcgtgctcggcgaacaggagcag
cgcacctgcgacgcctgcaccaaaaccgaaaccgttccgggtgtgggcctgacacccctc
atccaggaagagtacgacaccaagctgcagacgctgcaggagctgatcgacggcacacgc
aacaccaccttcgagaacctgcgcgacgccggcagcgtgtcactgccgatcacccggggc
gtcatcgaggcactgcgcgacgaaccggaccaacacgtcctggcgcaacgtcttgcctcg
gaagtcgccttggcatcggtgctggagaaagccttgctgctgcagcgcaccctgctgacc
ggcaggaaggagcccaacgtcgctgccaaccagttggcggtggctgccgtcgatcaggag
agcggcgcgctcgaccgggagatctcgaacctcaagactgaactggagctgcgccgcacg
ctcgccaacaactcgccgatggcgatcatccagcgccacagcacccgggccgccggttcg
cggggcatctacgagggcgaccccgtacccgaccgcctcgaccagctgcagcggcccaac
ccgggaggtacgccatga

DBGET integrated database retrieval system